KEGG   Halalkalicoccus jeotgali: HacjB3_09080Help
Entry
HacjB3_09080      CDS       T01271                                 

Definition
histone acetyltransferase, ELP3 family protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hje  Halalkalicoccus jeotgali
Brite
Enzymes [BR:hje01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     HacjB3_09080
Transfer RNA biogenesis [BR:hje03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    HacjB3_09080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1679450..1681105
Genome map
AA seq 551 aa AA seqDB search
MSTDVEPAESEAFEKACEELAERVLAGEIEREDVESAKLEVCSEFSSPKVPTNGDILAKA
PDDRREQAEAVLRRKPVRTASGVSPVAIMTSPHMCPHGKCLYCPGGPASEFDSAQSYTGH
EPAAARGVQNDYDPYGQVTLRLAQLREIGHPVDKVELILMGGTMTARSHDYQEHFVKRAL
EAMNDFDPENPPEPTEGESFAQSHDEYDFSYLEDVIAENETNGVRNIGTTFETKPDWCDP
EQIDRMLDLGGTKVEVGVQTTYERINREMHRGHGAQASIDANRRLRDAAFKVGFHMMPGQ
PGMSLDMCREDFQQLFEDANWRPDYLKIYPNLVVRGTRTYDMWRREEFDPLTNEQAAELV
AEIKAMLPKYVRLQRVQRDIPADFIDAGVWKSNLRQLARKRMAEHGWTCDCIRCREVGMN
DAEPQNVELDIMTYEAVGGIEKFVSFEDPDNDLLVGFCRLRFPGETVRRELENAALIREL
HVYGNELGVGTASDADWQHKGYGRRLMATAEDLAREAGFGKLSVISGIGAREYYKNKLGY
HQDGPYVSKRL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacgtcgagccagcggaatccgaggccttcgagaaggcctgcgaggaactc
gccgagcgcgtcctcgccggcgaaatcgagcgcgaagacgtcgaatccgccaaactcgag
gtctgttcggagttctcctcgccgaaggtaccgaccaacggtgacatcctcgcgaaagca
cccgacgaccgccgcgagcaagccgaggcggtgcttcgcaggaagcccgtgcgcaccgcc
tcgggggtctcgccggtggcgatcatgacctcgccacatatgtgtccccacgggaagtgt
ctctactgtcccggcggccccgcttcggagttcgacagcgcccagagctacacgggccac
gagcccgccgcggcccgcggggtccagaacgattacgacccctacggacaggtcacgctc
cggctcgcccaactcagggagatcggtcaccccgtcgataaggtcgaactcatcctgatg
ggcgggacgatgaccgcccggagccacgactaccaggagcacttcgtcaagcgcgcactg
gaggcgatgaacgacttcgatccggagaacccgcccgagccgaccgaaggcgagagtttc
gcccagagtcacgacgagtacgacttttcgtatctagaggacgtgatcgccgagaacgag
acgaacggcgtgcgaaacatcggcaccaccttcgaaaccaagcccgactggtgtgacccc
gagcagatcgaccggatgttggatctcggggggacgaaagtcgaggtcggcgtccagacc
acctacgagcgcatcaaccgggagatgcaccgcgggcacggggcacaagcgagcatcgac
gccaaccgccggctgcgcgacgcggcgttcaaggtcggctttcacatgatgcccggccag
cccggcatgagcctcgatatgtgccgggaggacttccagcagctgttcgaggacgcgaac
tggcgacccgactacctcaagatctaccccaacctcgtcgtccgggggacccggacctac
gatatgtggcgccgcgaggagttcgacccgttgaccaacgaacaggccgccgaactggtc
gcggagatcaaggcgatgctcccgaaatacgtccgccttcagcgcgtccagcgggacatc
cccgcggacttcatcgacgcaggcgtctggaagtcgaacctccggcaactggcccggaaa
cggatggcagaacatggctggacttgtgactgcatccggtgtcgggaggtcgggatgaac
gacgccgaaccccaaaacgtcgaactcgatatcatgacctacgaggcggtggggggtatc
gagaagttcgtcagtttcgaggaccccgacaacgacctgctggtcggcttctgtcgcctg
cgattccccggcgagacggtgcgtcgggagctcgaaaacgccgcgttgatccgtgagcta
cacgtctacggcaacgaactcggcgttggcacggcgagcgacgccgactggcagcacaag
ggctacggccgccgactgatggcgacagccgaagacctcgcacgcgaggccggcttcggg
aagctaagcgtcatctcgggaatcggcgcccgcgagtactacaagaacaaactcggctac
catcaggacggtccgtacgtctcgaagcgcctctga

DBGET integrated database retrieval system