KEGG   Halalkalicoccus jeotgali: HacjB3_12105Help
Entry
HacjB3_12105      CDS       T01271                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
hje00260  Glycine, serine and threonine metabolism
hje00750  Vitamin B6 metabolism
hje01100  Metabolic pathways
hje01110  Biosynthesis of secondary metabolites
hje01120  Microbial metabolism in diverse environments
hje01230  Biosynthesis of amino acids
Module
hje_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_12105
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HacjB3_12105
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HacjB3_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DZR zf-ribbon_3 zf-LYAR DUF35_N zinc_ribbon_2 HypA Zn-ribbon_8 zinc_ribbon_15
Motif
Other DBs
NCBI-ProteinID: ADJ15804
UniProt: D8J686
Position
2238423..2239619
Genome map
AA seq 398 aa AA seqDB search
METTAAFVGLSCIDCGERFDPDANRCPACGGILDPAYDYGVIDLTREELAERPFDSMWRY
EELLPFPRESAITIEEGATPLVECEKLAAEMGVGRVLIKDEGRNPTGSFKDRGQTVAMTA
AAQQGASDVALASAGNAGQAAAAYAGRADIDAHVFLPSRAGFTNKAMVNVHGGDMTVVGG
RIGDAGAAYADAMAEEGESEGWHSVGTFVTPYRHEGKKTMAYETIEQLDWEVPDAVVYPT
GGGVGLVGMHKAATELRELGLIDELPAMYAAQSSGCAPIVEAFEAGKDRHEPVEHPDTIC
GGIEIPDPGASPWILECLRESGGGAVATDDEEILESAIGVAKGEGVEMGATCAAAASGAW
KLADEGEFGADDTVVLLNTATSNKDSDVLRSHLMGKGI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaccgcggcgttcgtcggcctctcgtgtatcgactgtggcgagcggttcgac
ccggacgccaatcgctgtccggcgtgtggtggaatcctcgatcccgcctacgactacggg
gtgatcgacctcacgcgggaggaactcgccgagcgccccttcgactcgatgtggcgctac
gaggaactgttgcccttcccccgcgaatcggcgatcacgatcgaggagggcgcgacgccg
cttgtcgagtgcgaaaagctcgccgcggagatgggtgtcggccgggtgctgatcaaggac
gagggacggaacccgacggggagtttcaaggaccgcggccagacggtggcgatgaccgcc
gccgcccagcagggcgcgagcgacgtcgcgctcgcctcggcgggcaacgccgggcaggcc
gccgccgcctacgccggccgggccgacatcgacgcacacgtctttctcccctcgcgagcg
ggctttacgaacaaagcgatggtgaacgttcacggcggcgatatgaccgtcgtcggcggg
cggatcggcgacgcgggagcggcttacgccgacgcgatggccgaggagggcgagagcgag
gggtggcactctgtcgggacgttcgtcacgccctatcgtcatgagggaaagaagacgatg
gcctacgagacgatcgagcaactggactgggaagtacccgacgcggtcgtctacccgacc
ggcggcggggtcgggctcgtggggatgcacaaggccgcgacggaactgcgcgaactgggc
ctgatcgacgagctgcccgcgatgtacgccgcccagtcgagcggctgtgcaccgatcgtc
gaggcattcgaggccggcaaggaccgccacgagcccgtcgagcatcccgacacgatctgt
ggcgggatcgagatccccgatcccggcgcgagcccgtggatcctcgagtgcctgcgtgaa
tcgggcggcggcgcggtcgcgaccgacgacgaggagatcctcgaaagcgcgatcggggtc
gcgaaaggcgagggcgtcgagatgggtgcgacctgcgcggccgcggcaagcggcgcgtgg
aaactcgccgacgagggcgagttcggtgccgacgacaccgttgtcctgctcaacaccgca
acctcgaacaaggacagcgacgtgttgcgaagccacctgatgggaaaagggatctga

DBGET integrated database retrieval system