KEGG   Halalkalicoccus jeotgali: HacjB3_12105Help
Entry
HacjB3_12105      CDS       T01271                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hje  Halalkalicoccus jeotgali
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hje00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HacjB3_12105
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HacjB3_12105
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HacjB3_12105
Enzymes [BR:hje01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HacjB3_12105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2238423..2239619
Genome map
AA seq 398 aa AA seqDB search
METTAAFVGLSCIDCGERFDPDANRCPACGGILDPAYDYGVIDLTREELAERPFDSMWRY
EELLPFPRESAITIEEGATPLVECEKLAAEMGVGRVLIKDEGRNPTGSFKDRGQTVAMTA
AAQQGASDVALASAGNAGQAAAAYAGRADIDAHVFLPSRAGFTNKAMVNVHGGDMTVVGG
RIGDAGAAYADAMAEEGESEGWHSVGTFVTPYRHEGKKTMAYETIEQLDWEVPDAVVYPT
GGGVGLVGMHKAATELRELGLIDELPAMYAAQSSGCAPIVEAFEAGKDRHEPVEHPDTIC
GGIEIPDPGASPWILECLRESGGGAVATDDEEILESAIGVAKGEGVEMGATCAAAASGAW
KLADEGEFGADDTVVLLNTATSNKDSDVLRSHLMGKGI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaccgcggcgttcgtcggcctctcgtgtatcgactgtggcgagcggttcgac
ccggacgccaatcgctgtccggcgtgtggtggaatcctcgatcccgcctacgactacggg
gtgatcgacctcacgcgggaggaactcgccgagcgccccttcgactcgatgtggcgctac
gaggaactgttgcccttcccccgcgaatcggcgatcacgatcgaggagggcgcgacgccg
cttgtcgagtgcgaaaagctcgccgcggagatgggtgtcggccgggtgctgatcaaggac
gagggacggaacccgacggggagtttcaaggaccgcggccagacggtggcgatgaccgcc
gccgcccagcagggcgcgagcgacgtcgcgctcgcctcggcgggcaacgccgggcaggcc
gccgccgcctacgccggccgggccgacatcgacgcacacgtctttctcccctcgcgagcg
ggctttacgaacaaagcgatggtgaacgttcacggcggcgatatgaccgtcgtcggcggg
cggatcggcgacgcgggagcggcttacgccgacgcgatggccgaggagggcgagagcgag
gggtggcactctgtcgggacgttcgtcacgccctatcgtcatgagggaaagaagacgatg
gcctacgagacgatcgagcaactggactgggaagtacccgacgcggtcgtctacccgacc
ggcggcggggtcgggctcgtggggatgcacaaggccgcgacggaactgcgcgaactgggc
ctgatcgacgagctgcccgcgatgtacgccgcccagtcgagcggctgtgcaccgatcgtc
gaggcattcgaggccggcaaggaccgccacgagcccgtcgagcatcccgacacgatctgt
ggcgggatcgagatccccgatcccggcgcgagcccgtggatcctcgagtgcctgcgtgaa
tcgggcggcggcgcggtcgcgaccgacgacgaggagatcctcgaaagcgcgatcggggtc
gcgaaaggcgagggcgtcgagatgggtgcgacctgcgcggccgcggcaagcggcgcgtgg
aaactcgccgacgagggcgagttcggtgccgacgacaccgttgtcctgctcaacaccgca
acctcgaacaaggacagcgacgtgttgcgaagccacctgatgggaaaagggatctga

DBGET integrated database retrieval system