KEGG   Haloarcula marismortui: rrnAC1884Help
Entry
rrnAC1884         CDS       T00211                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hma  Haloarcula marismortui
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    rrnAC1884 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    rrnAC1884 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    rrnAC1884 (trpA)
Enzymes [BR:hma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     rrnAC1884 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
I:complement(1681646..1682527)
Genome map
AA seq 293 aa AA seqDB search
MGLERAFADEPAFVPYLAAGDPNYEASLEYVEALARGGADVIELGLPFSEPIAEGKTIQN
AIVRSLEAGMTPDRFFQFVEDLDVDVPLVCMTYYNLIYQYGEGDSESRSDSENASGETAS
QGPRPFVEKAAAVGIEGLVVPDLPGEEAGPLRTACDEFDLDLVFIVAPTTKGDRLERMLE
QVSGYVYVQARLGVTGAREDVDDATEDSLARLSDWDVPKAVGFGIKTGAHAERIVSAGAD
GIIVGSALVDIVAEGHENGDSTDAVADRLEAKARELKEGALRGAAERPQPERT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggactcgaacgcgcgttcgccgacgagcctgctttcgtcccgtaccttgcggccggc
gacccgaactacgaggcgtcgctagaatacgtcgaggcgctagcccgcggcggcgcggat
gtcatcgaactcggcctgccgttttccgagccgattgctgagggcaaaactatccagaac
gctatcgtccgctcgctggaagccgggatgacgcctgaccgcttcttccagttcgtcgag
gacctcgacgtggacgtgccgctggtgtgtatgacctactacaacctcatctatcagtac
ggtgagggtgatagcgagtcgcgaagcgactcggaaaacgcgagcggtgaaaccgcgagc
cagggaccccgccccttcgtcgagaaggccgccgcggtcggcatcgaggggctcgtcgtc
ccggacctccccggagaggaagccggcccgctccggacggcctgtgatgaattcgacctt
gacctggtgttcattgtcgcaccaacgacgaagggtgaccggctcgaacggatgctcgaa
caggtgtctggctacgtgtacgtgcaggcccgtctgggcgtcaccggcgcgcgcgaggac
gtagatgatgctaccgaggactcgctggcccgactgtccgattgggacgtgcccaaggct
gtcgggttcggcatcaagaccggtgcccacgccgaacgaatcgtttctgccggcgctgac
ggtatcatcgtcggctccgcgctggtcgatatcgtcgccgagggccacgagaacggcgat
tcgaccgatgctgtggccgaccggctcgaagcgaaggctcgcgaactcaaagagggggcg
ctccggggagcggcagaacgaccgcaaccggaacgcacataa

DBGET integrated database retrieval system