KEGG   Hydra vulgaris: 100197379Help
Entry
100197379         CDS       T01080                                 

Definition
DNA repair protein XRCC4-like
Orthology
K10886  
DNA-repair protein XRCC4
Organism
hmg  Hydra vulgaris
Pathway
Non-homologous end-joining
Class
Genetic Information Processing; Replication and repair; Non-homologous end-joining [PATH:hmg03450]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 205 aa AA seqDB search
MNLNKVLINNQTYFIFSSFKSGINLRLTNGWEVYNGNVSEHQLSLMANRIDMCPLTFLQS
IKDAFCNNSLSELFSFDLNKMENSCELVWKKILSDETKFQLASLTLQKDNHSAPILSLLE
GAMETVQMLSRSVTKLEKDNMLLEKETNTLTKRMENYVQTKDELEQQLFSKFCLVLNEKK
ARIRYLKNELEQKTWKSNQSIGNTM
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaataaagtccttataaataatcaaacatattttattttctcaagttttaaa
agtggaataaatttacgtttaactaatggttgggaagtatataacggaaatgtctctgaa
catcaactttcacttatggcaaatagaatcgatatgtgtcctctaactttcttacagtca
attaaagatgcattttgtaataatagtttatctgaattgttttcatttgatctgaacaaa
atggaaaattcatgcgagcttgtatggaaaaagattctatcagatgaaacaaagtttcaa
cttgctagtctaacactccaaaaagataatcattcagctcccatattatctttgttagag
ggagctatggaaactgttcaaatgctgtcgaggagtgtaacaaaacttgaaaaggacaac
atgttgttggaaaaagaaaccaatactttaactaagagaatggagaattatgttcaaaca
aaagatgaattagaacaacaacttttttcaaagttttgcttggttttaaatgaaaagaag
gcacgaattcgctacctaaagaatgaattggagcaaaaaacttggaaatccaatcaatca
ataggtaatacaatgtaa

DBGET integrated database retrieval system