KEGG   Hydra vulgaris: 100197379Help
Entry
100197379         CDS       T01080                                 

Definition
(RefSeq) DNA repair protein XRCC4-like
  KO
K10886  
DNA-repair protein XRCC4
Organism
hmg  Hydra vulgaris
Pathway
Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    100197379
DNA repair and recombination proteins [BR:hmg03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     100197379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 298 aa AA seqDB search
MNLNKVLINNQTYFIFSSFKSGINLRLTNGWEVYNGNVSEHQLSLMANRIDMCPLTFLQS
IKDAFCNNSLSELFSFDLNKMENSCELVWKKILSDETKFQLASLTLQKDNHSAPILSLLE
GAMETVQMLSRSVTKLEKDNMLLEKETNTLTKRMENYVQTKDELEQQLFSKFCLVLNEKK
ARIRYLKNELEQKTWKSNQSIENKAAKSAELESIDIYDIKRKKIDLDASHIVSRENDSIN
ILNKSIEPESFDVPKSSRRKIRSSKIGKPVAMQQSLASTSISKVSEEYSADNLLDDLF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaacttaaataaagtccttataaataatcaaacatattttattttctcaagttttaaa
agtggaataaatttacgtttaactaatggttgggaagtatataacggaaatgtctctgaa
catcaactttcacttatggcaaatagaatcgatatgtgtcctctaactttcttacagtca
attaaagatgcattttgtaataatagtttatctgaattgttttcatttgatctgaacaaa
atggaaaattcatgcgagcttgtatggaaaaagattctatcagatgaaacaaagtttcaa
cttgctagtctaacactccaaaaagataatcattcagctcccatattatctttgttagag
ggagctatggaaactgttcaaatgctgtcgaggagtgtaacaaaacttgaaaaggacaac
atgttgttggaaaaagaaaccaatactttaactaagagaatggagaattatgttcaaaca
aaagatgaattagaacaacaacttttttcaaagttttgcttggttttaaatgaaaagaag
gcacgaattcgctacctaaagaatgaattggagcaaaaaacttggaaatccaatcaatca
atagaaaataaagcagcaaaaagtgcagaattagaaagtatcgatatttatgatatcaaa
cgtaaaaagatagatttagatgcttctcatattgtctccagagaaaacgattcaattaat
atattgaacaagtcaatagaacctgaaagttttgatgttcctaaaagtagtaggagaaaa
attcgctcttcaaaaatagggaaaccggtggccatgcagcaaagtttagcaagtacgtca
atatcgaaagtttctgaggaatatagtgccgataacttactcgacgatttgttctaa

DBGET integrated database retrieval system