KEGG   Hydra vulgaris: 100201764Help
Entry
100201764         CDS       T01080                                 

Definition
arginase-1-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hmg  Hydra vulgaris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:hmg01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hmg00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 331 aa AA seqDB search
MSEAIQKYMFLKSNTVGIVGVSVKEGQNLLGVELAPEKIRSGGLFEVIKSLNWDYSDKGD
IKTEDIQTQKCSAKIYKYEELKNVDIIGAANEKLHNKTSEIAELGQFCITLGGDHGCASG
SISGLKKVYKDLKVIWVDAHSDCNIPETSPSGNYHGMPVAHLLGWIPDGSVPGFDWFKSC
LKNEDIVIIGLRDVDEGEKVLLKKHGIKCFSMHDVVKYGISGVMEKTFEYFRKDGVDHPI
HISYDVDGIDPTVAYGTGTKARGGLLYREAHYIVREVVSTGQFVSMDVVEVNPLLDKEKE
YFHGDSKLIKGTETVCLAIELCASALGYTLL
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaagcaatacagaagtacatgtttctcaaatcaaacacagtagggattgtaggt
gtctctgtaaaggaaggacaaaatctattaggtgtagaacttgcccctgaaaaaattcgg
agtggtggactttttgaagtcataaagagtttaaattgggactattcagacaaaggagat
atcaaaaccgaagatattcaaacacaaaaatgctctgcaaagatatacaagtacgaagaa
cttaagaatgtcgatattattggtgcagcgaacgaaaagctacacaataaaacttcagag
atcgctgaattaggacagttttgcattactctcggaggtgatcatggatgtgcatctgga
tccatttcagggctaaagaaagtttataaagatttaaaggtaatatgggtagatgcgcac
tctgattgcaacattcccgaaacttctccgagcggaaattatcatggaatgcctgttgct
catttacttggttggattcctgacggaagtgttcctggttttgattggtttaaaagttgt
ttgaaaaacgaggatattgtaataattggtttgagagacgttgatgaaggagaaaaggtt
ttacttaaaaagcatggaattaaatgcttctcaatgcatgatgtagtcaaatatggaatc
tcaggggtaatggagaaaacatttgagtatttcagaaaagatggagtagatcacccaatt
catattagctatgacgtagacggtattgatcctacagtagcttacggaacaggaacaaaa
gctcgaggtggcttattgtacagagaagctcactatatagtaagagaggttgtaagtact
ggacaatttgtcagtatggatgttgttgaggtaaatcctttacttgacaaagaaaaagaa
tacttccatggagatagtaagctaattaaaggcacagaaactgtttgcttggctattgaa
ctttgtgcttcagcgcttggatacaccttgctataa

DBGET integrated database retrieval system