KEGG   Hydra vulgaris: 100205405Help
Entry
100205405         CDS       T01080                                 

Definition
arginase, hepatic-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hmg  Hydra vulgaris
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:hmg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100205405
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100205405
Enzymes [BR:hmg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100205405
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 332 aa AA seqDB search
MIRAIQKQYKFLKSNTVGIVGVSVKEGQNLPGVELAPEKIRSGGLFEVIKSLNWDYSDKG
DIKTENIQIQERPSKIYKFNNFKNADIIGAVNEKLHNTTSEIAELGQFCITLGGDHGCAS
GSISGLKKVYKDLKVIWIDAHSDCNTPETSPSGNYHGMPVAHLFGWIPDGSVPGFDWFKS
CLQKEDIVIIGLRDVDKEEKALIGKHGIKCFTMHDVVKYGIAGVMEKTFEYFRKDGVDHP
IHISYDVDGIDPTVAYGTGTKARGGLLYREAHYIVREVVSTGLFVSMDVVEVNPLLDKEK
EYFHGDNKLIKGTETVCLAIELCASALGDTLL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatacgagcaatacaaaagcagtacaagttcttaaagtctaacactgtagggattgtt
ggagtttctgtaaaggaggggcaaaatttaccaggtgtagaacttgcccctgaaaaaatt
cgaagtggtggactttttgaagtcataaagagtttaaattgggactattcagacaaagga
gatatcaaaaccgaaaacattcaaatacaagaacgcccatcaaagatatacaagttcaac
aattttaagaatgcagatattattggtgcagttaacgaaaagctacacaacacaacttca
gagatcgctgaattaggacagttttgcattactctcggaggtgatcatggatgtgcatct
ggatccatttcagggctaaagaaagtttataaagatttaaaggtgatatggatcgatgca
cactctgattgcaatactccggagacttctccgagtggaaattaccatgggatgcctgtt
gctcatttatttggttggattcctgacggaagtgttcctggttttgattggtttaaaagt
tgcttacaaaaagaggatatagttataattggtttaagagatgttgacaaagaagaaaaa
gctttaataggtaaacatggaattaaatgcttcacaatgcatgatgtagtcaaatacgga
atcgcaggagtgatggagaagacattcgagtatttcagaaaagacggagtcgatcaccca
attcatattagctatgatgtagacggtattgatcctacagtagcttacggaacaggaaca
aaagctagaggtggtttattgtacagagaagctcactatatagtaagagaagttgtaagt
actggactatttgtcagtatggatgttgttgaggtaaatcctttacttgacaaagaaaaa
gaatactttcatggagataataaactaattaaaggcacagaaactgtttgcttggctatt
gaactttgtgcttcagcgcttggagatactttgctataa

DBGET integrated database retrieval system