KEGG   Helicobacter mustelae: HMU12820Help
Entry
HMU12820          CDS       T01191                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
hms  Helicobacter mustelae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hms00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1396539..1397108)
Genome map
AA seq 189 aa AA seqDB search
MRALFFTPHFPLAPLDSSSNVFTRKFGFLCRPKGFHSKRFYFPPASQNFLTLGIGGNEGD
VIATFTKLILWLKNHPNFHFIITSPIYRNPAFGYKNQPDFYNATISLITNLNLNAIYHLV
FYLERKFGRARKRRFKNAPRTLDIDILFFGHKVVKYPHLKIPHPAWKQRESVIIPLLLQS
LVMQGEKGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccttatttttcactccccatttccccctggcgcctcttgactcctcctcaaat
gtttttactaggaagtttggttttctttgcaggcctaagggatttcattccaagagattt
tatttccctcctgcatcacaaaatttcctaactcttgggattggggggaatgagggggat
gtgattgctacttttacaaaactcatcctttggctcaaaaatcatcccaattttcatttc
atcatcacaagccccatttatcgtaatcctgcttttggatacaaaaatcagccagatttt
tataatgccaccatttctctcatcacgaatttgaatctgaatgcaatctatcatctggtg
ttttatttggagcgaaaatttggcagagctaggaagcggagattcaaaaatgccccgcgc
acactggacattgatattttattttttgggcacaaagtggtaaaatacccgcatctaaag
attccccatcctgcgtggaagcaaagagaatctgttataataccgctattgttacaaagc
ttagtgatgcaaggagaaaaaggaagatga

DBGET integrated database retrieval system