KEGG   Helicobacter pylori PeCan4: HPPC_05390Help
Entry
HPPC_05390        CDS       T01322                                 

Gene name
porD
Definition
(GenBank) pyruvate flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
hpc  Helicobacter pylori PeCan4
Pathway
hpc00010  Glycolysis / Gluconeogenesis
hpc00020  Citrate cycle (TCA cycle)
hpc00620  Pyruvate metabolism
hpc00640  Propanoate metabolism
hpc00650  Butanoate metabolism
hpc00680  Methane metabolism
hpc01100  Metabolic pathways
hpc01120  Microbial metabolism in diverse environments
hpc01130  Biosynthesis of antibiotics
hpc01200  Carbon metabolism
Module
hpc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPPC_05390 (porD)
   00020 Citrate cycle (TCA cycle)
    HPPC_05390 (porD)
   00620 Pyruvate metabolism
    HPPC_05390 (porD)
   00640 Propanoate metabolism
    HPPC_05390 (porD)
   00650 Butanoate metabolism
    HPPC_05390 (porD)
  Energy metabolism
   00680 Methane metabolism
    HPPC_05390 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HPPC_05390 (porD)
Enzymes [BR:hpc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HPPC_05390 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_2 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_8 Fer4_4 Fer4_13 Fer4_22 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADO07290
UniProt: E1Q342
Position
1097655..1098047
Genome map
AA seq 130 aa AA seqDB search
MKDWNEFEMGAVLFPFEKNAQSEMEKHNDERHYTEQSYFTTSVAHWRVAKPVHNNNICIN
CFNCWVYCPDAAILSREGKLKGVDYSHCKGCGVCVDVCPTNPKSLWMFEEQIEPASALTQ
WPQKQEKKKS
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattggaatgaatttgaaatgggagcggtgctcttcccttttgaaaaaaacgcg
caaagcgaaatggaaaaacacaatgatgagcgccattacaccgagcaaagctacttcacc
acttcagtggctcattggcgcgtggctaagcctgtgcataacaataacatttgcatcaac
tgctttaattgttgggtttattgcccagacgctgctattctttcaagagagggcaagtta
aaaggcgtggattattctcattgtaaaggctgtggcgtgtgcgtggatgtctgccccacc
aaccctaaatcgctatggatgtttgaagaacaaattgagcctgctagtgctctcactcaa
tggccgcaaaaacaagaaaagaaaaaatcataa

DBGET integrated database retrieval system