KEGG   Helicobacter pylori ELS37: HPELS_06625Help
Entry
HPELS_06625       CDS       T01798                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
hpe  Helicobacter pylori ELS37
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HPELS_06625
   00030 Pentose phosphate pathway
    HPELS_06625
   00051 Fructose and mannose metabolism
    HPELS_06625
   00052 Galactose metabolism
    HPELS_06625
   00500 Starch and sucrose metabolism
    HPELS_06625
   00520 Amino sugar and nucleotide sugar metabolism
    HPELS_06625
  Nucleotide metabolism
   00230 Purine metabolism
    HPELS_06625
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HPELS_06625
Enzymes [BR:hpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HPELS_06625
    5.4.2.8  phosphomannomutase
     HPELS_06625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1346607..1347986
Genome map
AA seq 459 aa AA seqDB search
MDISIFREYDIRGIYPTTLDEKSAFSIGVELGKIMRECDKSVFVGHDARTHGRFLFEALS
AGLQSSGLKVYDLGLIPTPVAYFAAFNEINGIKCPNSIMITGSHNPKEYNGFKITLNQNP
FYGKDIQALKDTLLNAKHEIKPLKETPEKVNALEAYQRYLIKDFKHLKNLKYKIALDFGN
GVGALGLEPILKALNIDFSSLYSDPDGDFPNHHPDPSEAKNLKDLEKHMQENAILIGFAF
DGDADRIAMLSSHHIYAGDELAILFAKRLHAQGITPFVIGEVKCSQVMYNTINTFGKTLM
YKTGHSNLKIKLKETNAHFAAEMSGHIFFKERYFGYDDALYACLRALELLLEQSPSDLEN
TIKNLPYSYTTPEEKIAVSEEEKFEIIHNLQKALKNPPSHFPKIKEIISIDGVRVVFEHG
FGLIRASNTTPYLVSRFEGKDETTALEYKRALLGILEKL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atggacattagcatttttagagaatacgatattagaggcatttaccccaccactttagat
gaaaagagcgcttttagtattggcgtggagttggggaaaatcatgcgagaatgcgataaa
agcgtgtttgtagggcatgatgcgagaacgcatgggcgctttttgtttgaagctttgagc
gcggggctgcaatcaagcggcttgaaagtgtatgatttagggctaatccccacaccggta
gcgtattttgcagcctttaatgaaatcaatggcattaaatgccctaattctatcatgatt
actggatctcacaaccccaaagaatacaacggctttaaaatcacgctcaatcaaaacccg
ttttatggcaaggatattcaggctttaaaagacacgcttttaaacgcaaagcatgaaata
aaacccctaaaagaaacaccagagaaagtcaatgccctagaagcctatcagcgctatttg
atcaaggattttaagcatttgaaaaaccttaaatacaaaatcgccctggattttggcaat
ggcgtgggagcgttaggattagagccgattttaaaggctttaaacattgattttagcagc
ctttatagcgatcctgatggggattttcctaaccaccacccagaccctagcgaagcgaaa
aacttaaaagatttagaaaaacacatgcaagaaaacgctattttaataggctttgctttt
gatggcgatgcggataggatcgcgatgctaagctctcaccacatttatgcgggcgatgaa
ttggcgattttattcgctaaacgcttgcatgctcaaggcatcaccccttttgtgatcggc
gaagtcaaatgctctcaagtgatgtataacacgatcaatacttttggtaagacgctcatg
tataaaaccgggcatagcaatttaaaaatcaaactcaaagaaaccaacgcgcattttgcg
gctgaaatgagcgggcatatcttttttaaagaacgctattttggctatgatgacgctctt
tatgcatgcttaagggctttagaattattgctcgaacaaagtccaagcgatttggaaaac
accattaaaaacctcccctattcctacaccacgcctgaagaaaaaatcgccgtgagcgaa
gaagaaaaatttgaaatcattcataacctgcaaaaagcgcttaaaaacccgccaagccat
ttccctaaaatcaaagaaatcatcagcattgatggcgtgagggtggtttttgaacatggt
tttgggcttattcgcgcaagcaacaccaccccgtatttagtcagccgctttgaaggcaag
gatgaaacaacagcgttagaatataaaagggcgttgcttgggatattagaaaaactttaa

DBGET integrated database retrieval system