KEGG   Halovivax ruber: Halru_1456Help
Entry
Halru_1456        CDS       T02402                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hru  Halovivax ruber
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Halru_1456
   00670 One carbon pool by folate
    Halru_1456
Enzymes [BR:hru01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Halru_1456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1512513..1513112
Genome map
AA seq 199 aa AA seqDB search
MPGTDAGEVDNGFGDADRSDPAETAIETALELVAIVAVAENGVIGVDGEMPWHIPEDLAH
FKRETTGHPVIMGRVTYESIVAGLGEPLPDRTSIVLTSRAFETPENVLVVDGIDAAVRAA
ERADRERHDGSGRTYVAGGASVYEQLLPAVDRLVVTEVGRAPEGDAFFPEIDPSVWREVA
RDERESVTFLEYERIGSKA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgcctggaaccgacgctggcgaggtcgacaacgggttcggggacgccgatagatccgat
cccgccgaaacggcgatcgagacggccctcgaactcgtcgcgatcgtcgccgtcgccgaa
aacggcgtcatcggtgtcgacggggagatgccctggcacatccccgaggatctggcgcac
ttcaaacgagagacgaccgggcacccggttatcatgggtcgagtcacctacgagagcatc
gtcgcgggactcggcgagccgttgcccgatcgcacctcgatcgtcctcacctcacgcgcg
ttcgagacgcccgagaacgtgctggtggtcgacgggatcgacgcagccgttcgcgcggcc
gaacgggccgatcgcgaacgccacgacggatcgggtcgcacctacgtcgccggcggtgcg
tccgtctacgagcagttgctcccggccgtcgaccggctcgtcgtcaccgaggtcggtcgg
gcgccggagggcgacgccttcttcccggaaatcgacccttccgtctggcgcgaggtcgcg
agagacgaacgcgaatcggtcacgtttctcgagtacgaacgtatcggctcgaaagcgtag

DBGET integrated database retrieval system