KEGG   Homo sapiens (human): 120892Help
Entry
120892            CDS       T01001                                 

Gene name
LRRK2, AURA17, DARDARIN, PARK8, RIPK7, ROCO2
Definition
leucine-rich repeat kinase 2 (EC:2.7.11.1)
Orthology
K08844  
leucine-rich repeat kinase 2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Parkinson's disease
Disease
H00057  
Parkinson's disease (PD)
H00066  
Lewy body dementia (LBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    120892 (LRRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     120892 (LRRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  LRRK family
   120892 (LRRK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   120892 (LRRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q12
AA seq 2527 aa AA seqDB search
MASGSCQGCEEDEETLKKLIVRLNNVQEGKQIETLVQILEDLLVFTYSEHASKLFQGKNI
HVPLLIVLDSYMRVASVQQVGWSLLCKLIEVCPGTMQSLMGPQDVGNDWEVLGVHQLILK
MLTVHNASVNLSVIGLKTLDLLLTSGKITLLILDEESDIFMLIFDAMHSFPANDEVQKLG
CKALHVLFERVSEEQLTEFVENKDYMILLSALTNFKDEEEIVLHVLHCLHSLAIPCNNVE
VLMSGNVRCYNIVVEAMKAFPMSERIQEVSCCLLHRLTLGNFFNILVLNEVHEFVVKAVQ
QYPENAALQISALSCLALLTETIFLNQDLEEKNENQENDDEGEEDKLFWLEACYKALTWH
RKNKHVQEAACWALNNLLMYQNSLHEKIGDEDGHFPAHREVMLSMLMHSSSKEVFQASAN
ALSTLLEQNVNFRKILLSKGIHLNVLELMQKHIHSPEVAESGCKMLNHLFEGSNTSLDIM
AAVVPKILTVMKRHETSLPVQLEALRAILHFIVPGMPEESREDTEFHHKLNMVKKQCFKN
DIHKLVLAALNRFIGNPGIQKCGLKVISSIVHFPDALEMLSLEGAMDSVLHTLQMYPDDQ
EIQCLGLSLIGYLITKKNVFIGTGHLLAKILVSSLYRFKDVAEIQTKGFQTILAILKLSA
SFSKLLVHHSFDLVIFHQMSSNIMEQKDQQFLNLCCKCFAKVAMDDYLKNVMLERACDQN
NSIMVECLLLLGADANQAKEGSSLICQVCEKESSPKLVELLLNSGSREQDVRKALTISIG
KGDSQIISLLLRRLALDVANNSICLGGFCIGKVEPSWLGPLFPDKTSNLRKQTNIASTLA
RMVIRYQMKSAVEEGTASGSDGNFSEDVLSKFDEWTFIPDSSMDSVFAQSDDLDSEGSEG
SFLVKKKSNSISVGEFYRDAVLQRCSPNLQRHSNSLGPIFDHEDLLKRKRKILSSDDSLR
SSKLQSHMRHSDSISSLASEREYITSLDLSANELRDIDALSQKCCISVHLEHLEKLELHQ
NALTSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRNDIGPSVVLDPTV
KCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKILNLSKNH
ISSLSENFLEACPKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHLRS
LDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEI
PPEIGCLENLTSLDVSYNLELRSFPNEMGKLSKIWDLPLDELHLNFDFKHIGCKAKDIIR
FLQQRLKKAVPYNRMKLMIVGNTGSGKTTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQI
RDKRKRDLVLNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFNIKA
RASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGFPAIRDYHFVNATEESDALAKL
RKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVREN
QLQLDENELPHAVHFLNESGVLLHFQDPALQLSDLYFVEPKWLCKIMAQILTVKVEGCPK
HPKGIISRRDVEKFLSKKRKFPKNYMSQYFKLLEKFQIALPIGEEYLLVPSSLSDHRPVI
ELPHCENSEIIIRLYEMPYFPMGFWSRLINRLLEISPYMLSGRERALRPNRMYWRQGIYL
NWSPEAYCLVGSEVLDNHPESFLKITVPSCRKGCILLGQVVDHIDSLMEEWFPGLLEIDI
CGEGETLLKKWALYSFNDGEEHQKILLDDLMKKAEEGDLLVNPDQPRLTIPISQIAPDLI
LADLPRNIMLNNDELEFEQAPEFLLGDGSFGSVYRAAYEGEEVAVKIFNKHTSLRLLRQE
LVVLCHLHHPSLISLLAAGIRPRMLVMELASKGSLDRLLQQDKASLTRTLQHRIALHVAD
GLRYLHSAMIIYRDLKPHNVLLFTLYPNAAIIAKIADYGIAQYCCRMGIKTSEGTPGFRA
PEVARGNVIYNQQADVYSFGLLLYDILTTGGRIVEGLKFPNEFDELEIQGKLPDPVKEYG
CAPWPMVEKLIKQCLKENPQERPTSAQVFDILNSAELVCLTRRILLPKNVIVECMVATHH
NSRNASIWLGCGHTDRGQLSFLDLNTEGYTSEEVADSRILCLALVHLPVEKESWIVSGTQ
SGTLLVINTEDGKKRHTLEKMTDSVTCLYCNSFSKQSKQKNFLLVGTADGKLAIFEDKTV
KLKGAAPLKILNIGNVSTPLMCLSESTNSTERNVMWGGCGTKIFSFSNDFTIQKLIETRT
SQLFSYAAFSDSNIITVVVDTALYIAKQNSPVVEVWDKKTEKLCGLIDCVHFLREVMVKE
NKESKHKMSYSGRVKTLCLQKNTALWIGTGGGHILLLDLSTRRLIRVIYNFCNSVRVMMT
AQLGSLKNVMLVLGYNRKNTEGTQKQKEIQSCLTVWDINLPHEVQNLEKHIEVRKELAEK
MRRTSVE
NT seq 7584 nt NT seq  +upstreamnt  +downstreamnt
atggctagtggcagctgtcaggggtgcgaagaggacgaggaaactctgaagaagttgata
gtcaggctgaacaatgtccaggaaggaaaacagatagaaacgctggtccaaatcctggag
gatctgctggtgttcacgtactccgagcacgcctccaagttatttcaaggcaaaaatatc
catgtgcctctgttgatcgtcttggactcctatatgagagtcgcgagtgtgcagcaggtg
ggttggtcacttctgtgcaaattaatagaagtctgtccaggtacaatgcaaagcttaatg
ggaccccaggatgttggaaatgattgggaagtccttggtgttcaccaattgattcttaaa
atgctaacagttcataatgccagtgtaaacttgtcagtgattggactgaagaccttagat
ctcctcctaacttcaggtaaaatcaccttgctgatattggatgaagaaagtgatattttc
atgttaatttttgatgccatgcactcatttccagccaatgatgaagtccagaaacttgga
tgcaaagctttacatgtgctgtttgagagagtctcagaggagcaactgactgaatttgtt
gagaacaaagattatatgatattgttaagtgcgttaacaaattttaaagatgaagaggaa
attgtgcttcatgtgctgcattgtttacattccctagcgattccttgcaataatgtggaa
gtcctcatgagtggcaatgtcaggtgttataatattgtggtggaagctatgaaagcattc
cctatgagtgaaagaattcaagaagtgagttgctgtttgctccataggcttacattaggt
aattttttcaatatcctggtattaaacgaagtccatgagtttgtggtgaaagctgtgcag
cagtacccagagaatgcagcattgcagatctcagcgctcagctgtttggccctcctcact
gagactattttcttaaatcaagatttagaggaaaagaatgagaatcaagagaatgatgat
gagggggaagaagataaattgttttggctggaagcctgttacaaagcattaacgtggcat
agaaagaacaagcacgtgcaggaggccgcatgctgggcactaaataatctccttatgtac
caaaacagtttacatgagaagattggagatgaagatggccatttcccagctcatagggaa
gtgatgctctccatgctgatgcattcttcatcaaaggaagttttccaggcatctgcgaat
gcattgtcaactctcttagaacaaaatgttaatttcagaaaaatactgttatcaaaagga
atacacctgaatgttttggagttaatgcagaagcatatacattctcctgaagtggctgaa
agtggctgtaaaatgctaaatcatctttttgaaggaagcaacacttccctggatataatg
gcagcagtggtccccaaaatactaacagttatgaaacgtcatgagacatcattaccagtg
cagctggaggcgcttcgagctattttacattttatagtgcctggcatgccagaagaatcc
agggaggatacagaatttcatcataagctaaatatggttaaaaaacagtgtttcaagaat
gatattcacaaactggtcctagcagctttgaacaggttcattggaaatcctgggattcag
aaatgtggattaaaagtaatttcttctattgtacattttcctgatgcattagagatgtta
tccctggaaggtgctatggattcagtgcttcacacactgcagatgtatccagatgaccaa
gaaattcagtgtctgggtttaagtcttataggatacttgattacaaagaagaatgtgttc
ataggaactggacatctgctggcaaaaattctggtttccagcttataccgatttaaggat
gttgctgaaatacagactaaaggatttcagacaatcttagcaatcctcaaattgtcagca
tctttttctaagctgctggtgcatcattcatttgacttagtaatattccatcaaatgtct
tccaatatcatggaacaaaaggatcaacagtttctaaacctctgttgcaagtgttttgca
aaagtagctatggatgattacttaaaaaatgtgatgctagagagagcgtgtgatcagaat
aacagcatcatggttgaatgcttgcttctattgggagcagatgccaatcaagcaaaggag
ggatcttctttaatttgtcaggtatgtgagaaagagagcagtcccaaattggtggaactc
ttactgaatagtggatctcgtgaacaagatgtacgaaaagcgttgacgataagcattggg
aaaggtgacagccagatcatcagcttgctcttaaggaggctggccctggatgtggccaac
aatagcatttgccttggaggattttgtataggaaaagttgaaccttcttggcttggtcct
ttatttccagataagacttctaatttaaggaaacaaacaaatatagcatctacactagca
agaatggtgatcagatatcagatgaaaagtgctgtggaagaaggaacagcctcaggcagc
gatggaaatttttctgaagatgtgctgtctaaatttgatgaatggacctttattcctgac
tcttctatggacagtgtgtttgctcaaagtgatgacctggatagtgaaggaagtgaaggc
tcatttcttgtgaaaaagaaatctaattcaattagtgtaggagaattttaccgagatgcc
gtattacagcgttgctcaccaaatttgcaaagacattccaattccttggggcccattttt
gatcatgaagatttactgaagcgaaaaagaaaaatattatcttcagatgattcactcagg
tcatcaaaacttcaatcccatatgaggcattcagacagcatttcttctctggcttctgag
agagaatatattacatcactagacctttcagcaaatgaactaagagatattgatgcccta
agccagaaatgctgtataagtgttcatttggagcatcttgaaaagctggagcttcaccag
aatgcactcacgagctttccacaacagctatgtgaaactctgaagagtttgacacatttg
gacttgcacagtaataaatttacatcatttccttcttatttgttgaaaatgagttgtatt
gctaatcttgatgtctctcgaaatgacattggaccctcagtggttttagatcctacagtg
aaatgtccaactctgaaacagtttaacctgtcatataaccagctgtcttttgtacctgag
aacctcactgatgtggtagagaaactggagcagctcattttagaaggaaataaaatatca
gggatatgctcccccttgagactgaaggaactgaagattttaaaccttagtaagaaccac
atttcatccctatcagagaactttcttgaggcttgtcctaaagtggagagtttcagtgcc
agaatgaattttcttgctgctatgcctttcttgcctccttctatgacaatcctaaaatta
tctcagaacaaattttcctgtattccagaagcaattttaaatcttccacacttgcggtct
ttagatatgagcagcaatgatattcagtacctaccaggtcccgcacactggaaatctttg
aacttaagggaactcttatttagccataatcagatcagcatcttggacttgagtgaaaaa
gcatatttatggtctagagtagagaaactgcatctttctcacaataaactgaaagagatt
cctcctgagattggctgtcttgaaaatctgacatctctggatgtcagttacaacttggaa
ctaagatcctttcccaatgaaatggggaaattaagcaaaatatgggatcttcctttggat
gaactgcatcttaactttgattttaaacatataggatgtaaagccaaagacatcataagg
tttcttcaacagcgattaaaaaaggctgtgccttataaccgaatgaaacttatgattgtg
ggaaatactgggagtggtaaaaccaccttattgcagcaattaatgaaaaccaagaaatca
gatcttggaatgcaaagtgccacagttggcatagatgtgaaagactggcctatccaaata
agagacaaaagaaagagagatctcgtcctaaatgtgtgggattttgcaggtcgtgaggaa
ttctatagtactcatccccattttatgacgcagcgagcattgtaccttgctgtctatgac
ctcagcaagggacaggctgaagttgatgccatgaagccttggctcttcaatataaaggct
cgcgcttcttcttcccctgtgattctcgttggcacacatttggatgtttctgatgagaag
caacgcaaagcctgcatgagtaaaatcaccaaggaactcctgaataagcgagggttccct
gccatacgagattaccactttgtgaatgccaccgaggaatctgatgctttggcaaaactt
cggaaaaccatcataaacgagagccttaatttcaagatccgagatcagcttgttgttgga
cagctgattccagactgctatgtagaacttgaaaaaatcattttatcggagcgtaaaaat
gtgccaattgaatttcccgtaattgaccggaaacgattattacaactagtgagagaaaat
cagctgcagttagatgaaaatgagcttcctcacgcagttcactttctaaatgaatcagga
gtccttcttcattttcaagacccagcactgcagttaagtgacttgtactttgtggaaccc
aagtggctttgtaaaatcatggcacagattttgacagtgaaagtggaaggttgtccaaaa
caccctaagggcattatttcgcgtagagatgtggaaaaatttctttcaaaaaaaaggaaa
tttccaaagaactacatgtcacagtattttaagctcctagaaaaattccagattgctttg
ccaataggagaagaatatttgctggttccaagcagtttgtctgaccacaggcctgtgata
gagcttccccattgtgagaactctgaaattatcatccgactatatgaaatgccttatttt
ccaatgggattttggtcaagattaatcaatcgattacttgagatttcaccttacatgctt
tcagggagagaacgagcacttcgcccaaacagaatgtattggcgacaaggcatttactta
aattggtctcctgaagcttattgtctggtaggatctgaagtcttagacaatcatccagag
agtttcttaaaaattacagttccttcttgtagaaaaggctgtattcttttgggccaagtt
gtggaccacattgattctctcatggaagaatggtttcctgggttgctggagattgatatt
tgtggtgaaggagaaactctgttgaagaaatgggcattatatagttttaatgatggtgaa
gaacatcaaaaaatcttacttgatgacttgatgaagaaagcagaggaaggagatctctta
gtaaatccagatcaaccaaggctcaccattccaatatctcagattgcccctgacttgatt
ttggctgacctgcctagaaatattatgttgaataatgatgagttggaatttgaacaagct
ccagagtttctcctaggtgatggcagttttggatcagtttaccgagcagcctatgaagga
gaagaagtggctgtgaagatttttaataaacatacatcactcaggctgttaagacaagag
cttgtggtgctttgccacctccaccaccccagtttgatatctttgctggcagctgggatt
cgtccccggatgttggtgatggagttagcctccaagggttccttggatcgcctgcttcag
caggacaaagccagcctcactagaaccctacagcacaggattgcactccacgtagctgat
ggtttgagatacctccactcagccatgattatataccgagacctgaaaccccacaatgtg
ctgcttttcacactgtatcccaatgctgccatcattgcaaagattgctgactacggcatt
gctcagtactgctgtagaatggggataaaaacatcagagggcacaccagggtttcgtgca
cctgaagttgccagaggaaatgtcatttataaccaacaggctgatgtttattcatttggt
ttactactctatgacattttgacaactggaggtagaatagtagagggtttgaagtttcca
aatgagtttgatgaattagaaatacaaggaaaattacctgatccagttaaagaatatggt
tgtgccccatggcctatggttgagaaattaattaaacagtgtttgaaagaaaatcctcaa
gaaaggcctacttctgcccaggtctttgacattttgaattcagctgaattagtctgtctg
acgagacgcattttattacctaaaaacgtaattgttgaatgcatggttgctacacatcac
aacagcaggaatgcaagcatttggctgggctgtgggcacaccgacagaggacagctctca
tttcttgacttaaatactgaaggatacacttctgaggaagttgctgatagtagaatattg
tgcttagccttggtgcatcttcctgttgaaaaggaaagctggattgtgtctgggacacag
tctggtactctcctggtcatcaataccgaagatgggaaaaagagacataccctagaaaag
atgactgattctgtcacttgtttgtattgcaattccttttccaagcaaagcaaacaaaaa
aattttcttttggttggaaccgctgatggcaagttagcaatttttgaagataagactgtt
aagcttaaaggagctgctcctttgaagatactaaatataggaaatgtcagtactccattg
atgtgtttgagtgaatccacaaattcaacggaaagaaatgtaatgtggggaggatgtggc
acaaagattttctccttttctaatgatttcaccattcagaaactcattgagacaagaaca
agccaactgttttcttatgcagctttcagtgattccaacatcataacagtggtggtagac
actgctctctatattgctaagcaaaatagccctgttgtggaagtgtgggataagaaaact
gaaaaactctgtggactaatagactgcgtgcactttttaagggaggtaatggtaaaagaa
aacaaggaatcaaaacacaaaatgtcttattctgggagagtgaaaaccctctgccttcag
aagaacactgctctttggataggaactggaggaggccatattttactcctggatctttca
actcgtcgacttatacgtgtaatttacaacttttgtaattcggtcagagtcatgatgaca
gcacagctaggaagccttaaaaatgtcatgctggtattgggctacaaccggaaaaatact
gaaggtacacaaaagcagaaagagatacaatcttgcttgaccgtttgggacatcaatctt
ccacatgaagtgcaaaatttagaaaaacacattgaagtgagaaaagaattagctgaaaaa
atgagacgaacatctgttgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system