KEGG   Homo sapiens (human): 1302Help
Entry
1302              CDS       T01001                                 

Gene name
COL11A2, DFNA13, DFNB53, FBCG2, HKE5, PARP, STL3
Definition
collagen, type XI, alpha 2
Orthology
K06236  
collagen, type I/II/III/V/XI/XXIV/XXVII, alpha
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Platelet activation
Protein digestion and absorption
Amoebiasis
Disease
H00431  
Ossification of the posterior longitudinal ligament of spine (OPLL)
H00519  
Type XI collagenopathies
H00604  
Deafness, autosomal dominant
H00605  
Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1302 (COL11A2)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    1302 (COL11A2)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    1302 (COL11A2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    1302 (COL11A2)
  Digestive system
   04974 Protein digestion and absorption
    1302 (COL11A2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    1302 (COL11A2)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  1302 (COL11A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 290 aa AA seqDB search
MERCSRCHRLLLLLPLVLGLSAAPGWAGAPPVDVLRALRFPSLPDGVRRAKGICPADVAY
RVARPAQLSAPTRQLFPGGFPKDFSLLTVVRTRPGLQAPLLTLYSAQGVRQLGLELGRPV
RFLYEDQTGRPQPPSQPVFRGLSLADGKWHRVAVAVKGQSVTLIVDCKKRVTRPLPRSAR
PVLDTHGVIIFGARILDEEVFEGDVQELAIVPGVQAAYESCEQKELECEGGQRERPQNQQ
PHRAQRSPQQQPSRLHRPQNQEPQSQVRELGEPPSAAHPREGRHPGISPP
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggagcggtgcagccgctgccatcgcctcctcctcctcctacctctggtgctggggctg
agcgcggccccaggctgggcaggtgcaccccctgtggatgtgctccgggccctgaggttc
ccctccctccctgatggtgtccggagagcgaaaggcatctgtccagctgatgtggcctac
cgagtggcacgacctgcccagctcagtgcacccactcgccagcttttcccaggaggattt
cccaaagatttctctctgctgactgttgtccggacccgccctggtctccaagctcccctc
ctgactctctacagtgcccagggtgtccgacagctgggcctggagctgggccgacctgtc
cgcttcctgtatgaagaccagactgggcggcctcaacctccctctcagccagtcttccga
ggcctcagcctagcagatggcaagtggcaccgtgtggctgtggctgtgaagggccagtct
gtcaccctcattgttgactgcaagaagcgagtcacccggcctctcccccgaagtgctcgt
ccagtattggacacccatggagtgatcatctttggtgcccgtattctggatgaagaagtc
tttgagggtgatgtccaggagctggccattgtcccaggggtccaggcagcctatgaatca
tgtgaacagaaggagctggaatgcgaggggggccagagggaaagaccccaaaaccaacag
cctcacagagcccagagatctccacagcagcaaccatcaagacttcacaggccacaaaat
caggaaccccagagccaggtgagggagctgggagaacccccaagtgcagcacaccccaga
gagggaagacacccaggcatctctcctccttag

DBGET integrated database retrieval system