KEGG   Homo sapiens (human): 136647Help
Entry
136647            CDS       T01001                                 

Gene name
MPLKIP, ABHS, C7orf11, ORF20
Definition
M-phase specific PLK1 interacting protein
Organism
hsa  Homo sapiens (human)
Disease
H00866  
Trichothiodystrophy non-photosensitive type 1 (TTDN1)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
7p14.1
AA seq 179 aa AA seqDB search
MQRQNFRPPTPPYPGPGGGGWGSGSSFRGTPGGGGPRPPSPRDGYGSPHHTPPYGPRSRP
YGSSHSPRHGGSFPGGRFGSPSPGGYPGSYSRSPAGSQQQFGYSPGQQQTHPQGSPRTST
PFGSGRVREKRMSNELENYFKPSMLEDPWAGLEPVSVVDISQQYSNTQTFTGKKGRYFC
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgacagaattttcggcccccaactcctccttaccctggtccgggtggaggaggt
tggggtagcggaagcagcttccggggaaccccgggcgggggcggaccacggccgccctcc
cctcgagacgggtacgggagtccgcaccacacgccgccgtacgggccccggtctaggccg
tacgggagcagtcactctccgcgacacggcggcagcttcccggggggccggttcgggtct
ccgtcccctggcggctaccctggctcctactccaggtcccccgcggggtcccagcagcaa
ttcggctactccccagggcagcagcagacccacccccagggttctccaaggacatctaca
ccatttggatcagggcgtgttagagaaaaaagaatgtctaatgagttggaaaattatttc
aagccttcaatgcttgaagatccttgggctggcctagaaccagtatctgtagtggatata
agccaacaatacagcaatactcaaacattcacaggcaaaaaaggaagatacttttgttaa

DBGET integrated database retrieval system