KEGG   Homo sapiens (human): 147409Help
Entry
147409            CDS       T01001                                 

Gene name
DSG4, CDGF13, CDHF13, LAH
Definition
desmoglein 4
Orthology
K07599  
desmoglein 4
Organism
hsa  Homo sapiens (human)
Disease
H00784  
Localized autosomal recessive hypotrichosis
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q12.1
AA seq 1059 aa AA seqDB search
MDWLFFRNICLLIILMVVMEVNSEFIVEVKEFDIENGTTKWQTVRRQKREWIKFAAACRE
GEDNSKRNPIAKIRSDCESNQKITYRISGVGIDRPPYGVFTINPRTGEINITSVVDREIT
PLFLIYCRALNSRGEDLERPLELRVKVMDINDNAPVFSQSVYTASIEENSDANTLVVKLC
ATDADEENHLNSKIAYKIVSQEPSGAPMFILNRYTGEVCTMSSFLDREQHSMYNLVVRGS
DRDGAADGLSSECDCRIKVLDVNDNFPTLEKTSYSASIEENCLSSELIRLQAIDLDEEGT
DNWLAQYLILSGNDGNWFDIQTDPQTNEGILKVVKMLDYEQAPNIQLSIGVKNQADFHYS
VASQFQMHPTPVRIQVVDVREGPAFHPSTMAFSVREGIKGSSLLNYVLGTYTAIDLDTGN
PATDVRYIIGHDAGSWLKIDSRTGEIQFSREFDKKSKYIINGIYTAEILAIDDGSGKTAT
GTICIEVPDINDYCPNIFPERRTICIDSPSVLISVNEHSYGSPFTFCVVDEPPGIADMWD
VRSTNATSAILTAKQVLSPGFYEIPILVKDSYNRACELAQMVQLYACDCDDNHMCLDSGA
AGIYTEDITGDTYGPVTEDQAGVSNVGLGPAGIGMMVLGILLLILAPLLLLLCCCKQRQP
EGLGTRFAPVPEGGEGVMQSWRIEGAHPEDRLFSAYALPGGGGTADGGGSVLGRCALQAT
PALLNQHPPFSEIYTNTYAAGGTVEGGVSGVELNTGMGTAVGLMAAGAAGASGAARKRSS
TMGTLRDYADADINMAFLDSYFSEKAYAYADEDEGRPANDCLLIYDHEGVGSPVGSIGCC
SWIVDDLDESCMETLDPKFRTLAEICLNTEIEPFPSHQACIPISTDLPLLGPNYFVNESS
GLTPSEVEFQEEMAASEPVVHGDIIVTETYGNADPCVQPTTIIFDPQLAPNVVVTEAVMA
PVYDIQGNICVPAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEI
QVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQQ
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atggattggctcttcttcagaaacatttgccttttgatcattctaatggtggtgatggaa
gtaaacagtgaatttattgttgaggtgaaggaatttgacattgaaaatggcactacaaaa
tggcaaacagtcagaagacaaaagcgggagtggatcaagtttgccgcagcctgtcgagaa
ggagaggacaactcgaagaggaaccccattgccaaaattcgatcagactgcgaatcgaac
cagaagataacataccggatttctggagtagggattgatcgaccaccatatggggtattc
accattaatcctcgcactggggaaattaacatcacttcagtggtagacagagaaataact
ccacttttcttgatctattgccgggctctgaattcacggggtgaagatttagaaaggcct
cttgagcttagagtcaaagttatggacataaatgataacgctccagtcttttcgcaaagt
gtatacacagccagcattgaagaaaatagtgatgccaatacattggtagtaaagttatgt
gccacagatgcagatgaagaaaatcatctgaattctaaaattgcctacaagatcgtctct
caggagccatcaggtgcacccatgttcattctgaataggtacactggagaagtctgcacc
atgtccagtttcttggacagagagcaacacagtatgtacaacctggttgtgagaggctca
gatcgggatggagctgcagatggactgtcttctgagtgtgactgtagaatcaaggtttta
gacgtcaacgataatttccccaccttagagaaaacttcatactcagccagtattgaagag
aattgtttaagttcggaactgatacgattacaagcaattgatcttgatgaagaaggcact
gataactggttggctcaatatttaattctctctggaaatgatgggaattggttcgatatt
caaacagatccacaaaccaatgaaggcattttgaaagttgtcaagatgctggattatgaa
caagcacctaacattcagcttagtatcggagttaaaaaccaagctgattttcactactcc
gttgcttctcaattccaaatgcacccaacccctgtgagaattcaagttgttgatgtgaga
gaaggacctgcatttcatccaagtactatggcttttagtgtgcgggaaggaataaaagga
agttccttattgaattatgtgcttggcacatatacagccatagatttggacacaggaaac
cctgcaacagatgtcagatatatcatagggcatgatgcaggcagctggttaaaaattgat
tcaagaactggtgagatacaattttctagagaatttgataagaagtcaaaatatattatc
aatgggatatacacagcagagatcctggctatagatgatggctctggaaaaacagctaca
ggaaccatatgtattgaggttcctgatatcaatgattattgtccaaacatttttcctgaa
agaagaaccatctgcattgactctccatcagtccttatctctgttaatgaacattcttat
gggtctccgtttactttctgtgttgttgatgagccaccaggaatagctgacatgtgggat
gtcagatcaacaaatgctacctcggcaatccttacggctaagcaggttttatctccagga
ttttatgaaatcccaatcctggtgaaggacagctataacagagcatgtgaattggcacaa
atggtgcagttatatgcctgtgattgcgatgacaaccacatgtgcctggactctggtgcc
gcgggcatctacacagaggacataactggtgacacgtatgggcctgtcactgaagaccaa
gctggagtttcaaatgttggtcttggaccagcagggattggcatgatggttctgggcatc
ctgctactgattttggctccactcttgctgctcctgtgttgctgcaaacagagacagcca
gaaggcctgggaacaagatttgctcctgtgcctgagggcggagaaggagtgatgcagtct
tggagaattgaaggggcccatcccgaggacaggctttttagcgcctacgccttgccgggt
ggtggtggcaccgcagacggcggcggcagcgttttaggcagatgcgcgctgcaggcaact
ccagcgctgttaaaccaacatcctcccttttcagaaatctacaccaacacctatgcagcc
gggggcacggtggaaggaggtgtatcgggagtggagctcaacacaggtatggggacagcc
gttggcctcatggccgcaggggccgcaggagcctcaggggccgcaaggaagaggagctct
accatgggaaccctgcgggactacgctgacgcagacatcaacatggctttcttggacagc
tacttctcggagaaagcgtatgcttatgcagatgaagatgaaggtcgaccagccaatgac
tgcttgctcatttatgaccacgagggagtcgggtctcccgtaggctctattggttgttgc
agttggattgtggatgacttagatgaaagctgcatggaaactttagatccaaaatttagg
actcttgctgagatctgcttaaacacagaaattgaaccatttccttcacaccaggcttgt
ataccaatcagtactgacctccctttgctcggacctaattactttgttaatgaatcttca
ggattgactccctcagaagttgaattccaagaagaaatggcagcatctgaacccgtggtc
catggggatattattgtgactgagacttacggtaatgctgatccatgtgtgcaacccact
acaattatttttgatcctcagcttgcacccaatgttgtagtaaccgaagcagtaatggca
cctgtctatgatattcaagggaatatttgtgtacctgctgagttagcagattacaacaat
gtaatctatgctgagagagtactggctagtcctggtgtgcctgacatgagcaatagtagc
acgactgagggttgtatgggacctgtgatgagcggcaatattttagtagggccagaaatt
caagtgatgcaaatgatgagtccagaccttcccataggccaaaccgttggctccacatcc
cccatgacatctcgacacagagtaacacgatacagtaacatacattacacccaacagtaa

DBGET integrated database retrieval system