KEGG   Homo sapiens (human): 2175Help
Entry
2175              CDS       T01001                                 

Gene name
FANCA, FA, FA-H, FA1, FAA, FACA, FAH, FANCH
Definition
Fanconi anemia, complementation group A
Orthology
K10888  
fanconi anemia group A protein
Organism
hsa  Homo sapiens (human)
Pathway
Fanconi anemia pathway
Module
FA core complex
Disease
H00238  
Fanconi anemia
Class
Genetic Information Processing; Replication and repair; Fanconi anemia pathway [PATH:hsa03460]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 1455 aa AA seqDB search
MSDSWVPNSASGQDPGGRRRAWAELLAGRVKREKYNPERAQKLKESAVRLLRSHQDLNAL
LLEVEGPLCKKLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS
VGQICTAPAETSHPVLLTVEQRKKLSSLLEFAQYLLAHSMFSRLSFCQELWKIQSSLLLE
AVWHLHVQGIVSLQELLESHPDMHAVGSWLFRNLCCLCEQMEASCQHADVARAMLSDFVQ
MFVLRGFQKNSDLRRTVEPEKMPQVTVDVLQRMLIFALDALAAGVQEESSTHKIVRCWFG
VFSGHTLGSVISTDPLKRFFSHTLTQILTHSPVLKASDAVQMQREWSFARTHPLLTSLYR
RLFVMLSAEELVGHLQEVLETQEVHWQRVLSFVSALVVCFPEAQQLLEDWVARLMAQAFE
SCQLDSMVTAFLVVRQAALEGPSAFLSYADWFKASFGSTRGYHGCSKKALVFLFTFLSEL
VPFESPRYLQVHILHPPLVPGKYRSLLTDYISLAKTRLADLKVSIENMGLYEDLSSAGDI
TEPHSQALQDVEKAIMVFEHTGNIPVTVMEASIFRRPYYVSHFLPALLTPRVLPKVPDSR
VAFIESLKRADKIPPSLYSTYCQACSAAEEKPEDAALGVRAEPNSAEEPLGQLTAALGEL
RASMTDPSQRDVISAQVAVISERLRAVLGHNEDDSSVEISKIQLSINTPRLEPREHMAVD
LLLTSFCQNLMAASSVAPPERQGPWAALFVRTMCGRVLPAVLTRLCQLLRHQGPSLSAPH
VLGLAALAVHLGESRSALPEVDVGPPAPGAGLPVPALFDSLLTCRTRDSLFFCLKFCTAA
ISYSLCKFSSQSRDTLCSCLSPGLIKKFQFLMFRLFSEARQPLSEEDVASLSWRPLHLPS
ADWQRAALSLWTHRTFREVLKEEDVHLTYQDWLHLELEIQPEADALSDTERQDFHQWAIH
EHFLPESSASGGCDGDLQAACTILVNALMDFHQSSRSYDHSENSDLVFGGRTGNEDIISR
LQEMVADLELQQDLIVPLGHTPSQEHFLFEIFRRRLQALTSGWSVAASLQRQRELLMYKR
ILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFFRGLLN
ACLRSRDPSLMVDFILAKCQTKCPLILTSALVWWPSLEPVLLCRWRRHCQSPLPRELQKL
QEGRQFASDFLSPEAASPAPNPDWLSAAALHFAIQQVREENIRKQLKKLDCEREELLVFL
FFFSLMGLLSSHLTSNSTTDLPKAFHVCAAILECLEKRKISWLALFQLTESDLRLGRLLL
RVAPDQHTRLLPFAFYSLLSYFHEDAAIREEAFLHVAVDMYLKLVQLFVAGDTSTVSPPA
GRSLELKGQGNPVELITKARLFLLQLIPRCPKKSFSHVAELLADRGDCDPEVSAALQSRQ
QAAPDADLSQEPHLF
NT seq 4368 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgtgggtcccgaactccgcctcgggccaggacccagggggccgccggagg
gcctgggccgagctgctggcgggaagggtcaagagggaaaaatataatcctgaaagggca
cagaaattaaaggaatcagctgtgcgcctcctgcgaagccatcaggacctgaatgccctt
ttgcttgaggtagaaggtccactgtgtaaaaaattgtctctcagcaaagtgattgactgt
gacagttctgaggcctatgctaatcattctagttcatttataggctctgctttgcaggat
caagcctcaaggctgggggttcccgtgggtattctctcagccgggatggttgcctctagc
gtgggacagatctgcacggctccagcggagaccagtcaccctgtgctgctgactgtggag
cagagaaagaagctgtcttccctgttagagtttgctcagtatttattggcacacagtatg
ttctcccgtctttccttctgtcaagaattatggaaaatacagagttctttgttgcttgaa
gcggtgtggcatcttcacgtacaaggcattgtgagcctgcaagagctgctggaaagccat
cccgacatgcatgctgtgggatcgtggctcttcaggaatctgtgctgcctttgtgaacag
atggaagcatcctgccagcatgctgacgtcgccagggccatgctttctgattttgttcaa
atgtttgttttgaggggatttcagaaaaactcagatctgagaagaactgtggagcctgaa
aaaatgccgcaggtcacggttgatgtactgcagagaatgctgatttttgcacttgacgct
ttggctgctggagtacaggaggagtcctccactcacaagatcgtgaggtgctggttcgga
gtgttcagtggacacacgcttggcagtgtaatttccacagatcctctgaagaggttcttc
agtcataccctgactcagatactcactcacagccctgtgctgaaagcatctgatgctgtt
cagatgcagagagagtggagctttgcgcggacacaccctctgctcacctcactgtaccgc
aggctctttgtgatgctgagtgcagaggagttggttggccatttgcaagaagttctggaa
acgcaggaggttcactggcagagagtgctctcctttgtgtctgccctggttgtctgcttt
ccagaagcgcagcagctgcttgaagactgggtggcgcgtttgatggcccaggcattcgag
agctgccagctggacagcatggtcactgcgttcctggttgtgcgccaggcagcactggag
ggcccctctgcgttcctgtcatatgcagactggttcaaggcctcctttgggagcacacga
ggctaccatggctgcagcaagaaggccctggtcttcctgtttacgttcttgtcagaactc
gtgccttttgagtctccccggtacctgcaggtgcacattctccacccacccctggttccc
ggcaagtaccgctccctcctcacagactacatctcattggccaagacacggctggccgac
ctcaaggtttctatagaaaacatgggactctacgaggatttgtcatcagctggggacatt
actgagccccacagccaagctcttcaggatgttgaaaaggccatcatggtgtttgagcat
acggggaacatcccagtcaccgtcatggaggccagcatattcaggaggccttactacgtg
tcccacttcctccccgccctgctcacacctcgagtgctccccaaagtccctgactcccgt
gtggcgtttatagagtctctgaagagagcagataaaatccccccatctctgtactccacc
tactgccaggcctgctctgctgctgaagagaagccagaagatgcagccctgggagtgagg
gcagaacccaactctgctgaggagcccctgggacagctcacagctgcactgggagagctg
agagcctccatgacagaccccagccagcgtgatgttatatcggcacaggtggcagtgatt
tctgaaagactgagggctgtcctgggccacaatgaggatgacagcagcgttgagatatca
aagattcagctcagcatcaacacgccgagactggagccacgggaacacatggctgtggac
ctcctgctgacgtctttctgtcagaacctgatggctgcctccagtgtcgctcccccggag
aggcagggtccctgggctgccctcttcgtgaggaccatgtgtggacgtgtgctccctgca
gtgctcacccggctctgccagctgctccgtcaccagggcccgagcctgagtgccccacat
gtgctggggttggctgccctggccgtgcacctgggtgagtccaggtctgcgctcccagag
gtggatgtgggtcctcctgcacctggtgctggccttcctgtccctgcgctctttgacagc
ctcctgacctgtaggacgagggattccttgttcttctgcctgaaattttgtacagcagca
atttcttactctctctgcaagttttcttcccagtcacgagatactttgtgcagctgctta
tctccaggccttattaaaaagtttcagttcctcatgttcagattgttctcagaggcccga
cagcctctttctgaggaggacgtagccagcctttcctggagacccttgcaccttccttct
gcagactggcagagagctgccctctctctctggacacacagaaccttccgagaggtgttg
aaagaggaagatgttcacttaacttaccaagactggttacacctggagctggaaattcaa
cctgaagctgatgctctttcagatactgaacggcaggacttccaccagtgggcgatccat
gagcactttctccctgagtcctcggcttcagggggctgtgacggagacctgcaggctgcg
tgtaccattcttgtcaacgcactgatggatttccaccaaagctcaaggagttatgaccac
tcagaaaattctgatttggtctttggtggccgcacaggaaatgaggatattatttccaga
ttgcaggagatggtagctgacctggagctgcagcaagacctcatagtgcctctcggccac
accccttcccaggagcacttcctctttgagattttccgcagacggctccaggctctgaca
agcgggtggagcgtggctgccagccttcagagacagagggagctgctaatgtacaaacgg
atcctcctccgcctgccttcgtctgtcctctgcggcagcagcttccaggcagaacagccc
atcactgccagatgcgagcagttcttccacttggtcaactctgagatgagaaacttctgc
tcccacggaggtgccctgacacaggacatcactgcccacttcttcaggggcctcctgaac
gcctgtctgcggagcagagacccctccctgatggtcgacttcatactggccaagtgccag
acgaaatgccccttaattttgacctctgctctggtgtggtggccgagcctggagcctgtg
ctgctctgccggtggaggagacactgccagagcccgctgccccgggaactgcagaagcta
caagaaggccggcagtttgccagcgatttcctctcccctgaggctgcctccccagcaccc
aacccggactggctctcagctgctgcactgcactttgcgattcaacaagtcagggaagaa
aacatcaggaagcagctaaagaagctggactgcgagagagaggagctattggttttcctt
ttcttcttctccttgatgggcctgctgtcgtcacatctgacctcaaatagcaccacagac
ctgccaaaggctttccacgtttgtgcagcaatcctcgagtgtttagagaagaggaagata
tcctggctggcactctttcagttgacagagagtgacctcaggctggggcggctcctcctc
cgtgtggccccggatcagcacaccaggctgctgcctttcgctttttacagtcttctctcc
tacttccatgaagacgcggccatcagggaagaggccttcctgcatgttgctgtggacatg
tacttgaagctggtccagctcttcgtggctggggatacaagcacagtttcacctccagct
ggcaggagcctggagctcaagggtcagggcaaccccgtggaactgataacaaaagctcgt
ctttttctgctgcagttaatacctcggtgcccgaaaaagagcttctcacacgtggcagag
ctgctggctgatcgtggggactgcgacccagaggtgagcgccgccctccagagcagacag
caggctgcccctgacgctgacctgtcccaggagcctcatctcttctga

DBGET integrated database retrieval system