KEGG   Homo sapiens (human): 224Help
Entry
224               CDS       T01001                                 

Gene name
ALDH3A2, ALDH10, FALDH, SLS
Definition
aldehyde dehydrogenase 3 family, member A2 (EC:1.2.1.3)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00162  
Sjogren-Larsson syndrome
Drug target
Disulfiram: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    224 (ALDH3A2)
   00040 Pentose and glucuronate interconversions
    224 (ALDH3A2)
   00053 Ascorbate and aldarate metabolism
    224 (ALDH3A2)
   00620 Pyruvate metabolism
    224 (ALDH3A2)
  Lipid metabolism
   00071 Fatty acid degradation
    224 (ALDH3A2)
   00561 Glycerolipid metabolism
    224 (ALDH3A2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    224 (ALDH3A2)
   00310 Lysine degradation
    224 (ALDH3A2)
   00330 Arginine and proline metabolism
    224 (ALDH3A2)
   00340 Histidine metabolism
    224 (ALDH3A2)
   00380 Tryptophan metabolism
    224 (ALDH3A2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    224 (ALDH3A2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     224 (ALDH3A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 485 aa AA seqDB search
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgaagtccggcgggtccgacaggcgttcctgtccggccggtcgcgacctctg
cggtttcggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggat
atcctgacggccatcgccgccgacctgtgcaagagtgaattcaatgtgtacagtcaggaa
gtcattactgtccttggggaaattgattttatgcttgagaatcttcctgaatgggttact
gctaaaccagttaagaagaacgtgctcaccatgctggatgaggcctatattcagccacag
cctctgggagtggtgctgataatcggagcttggaattaccccttcgttctcaccattcag
ccactgataggagccatcgctgcaggaaatgctgtgattataaagccttctgaactgagt
gaaaatacagccaagatcttggcaaagcttctccctcagtatttagaccaggatctctat
attgttattaatggtggtgttgaggaaaccacggagctcctgaagcagcgatttgaccac
attttctatacgggaaacactgcggttggcaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgactcttgaactgggagggaaaagtccatgttatattgataaagattgt
gacctggacattgtttgcagacgcataacctggggaaaatacatgaattgtggccaaacc
tgcattgcacccgactatattctctgtgaagcatccctccaaaatcaaattgtatggaag
attaaggaaacagtgaaggaattttatggagaaaatataaaagagtctcctgattatgaa
aggatcatcaatcttcgtcattttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggggagactgatgaggccacacgctacatagccccaacagtacttaccgat
gttgatcctaaaaccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggct
ctttatgtattttcgcataaccataagctcatcaaacggatgattgatgagacatccagt
ggaggtgtcacaggcaatgacgtcattatgcacttcacgctcaactctttcccatttgga
ggagtgggttccagtgggatgggagcttatcacggaaaacatagttttgatactttttct
catcagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatat
cctcccaacagccagtcaaaggtggattggggaaaattttttctcttgaaacggttcaac
aaagaaaaactcggtctcctgttgctcactttcctgggtattgtagccgctgtgcttgtc
aaggcagaatattactga

DBGET integrated database retrieval system