KEGG   Homo sapiens (human): 224Help
Entry
224               CDS       T01001                                 

Gene name
ALDH3A2, ALDH10, FALDH, SLS
Definition
aldehyde dehydrogenase 3 family, member A2 (EC:1.2.1.3)
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Module
GABA biosynthesis, eukaryotes, putrescine => GABA
Disease
H00162  
Sjogren-Larsson syndrome
Drug target
Disulfiram: 
Other: 
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:hsa00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:hsa00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:hsa00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:hsa00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:hsa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:hsa00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hsa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:hsa00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:hsa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:hsa00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p11.2
AA seq 485 aa AA seqDB search
MELEVRRVRQAFLSGRSRPLRFRLQQLEALRRMVQEREKDILTAIAADLCKSEFNVYSQE
VITVLGEIDFMLENLPEWVTAKPVKKNVLTMLDEAYIQPQPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVIIKPSELSENTAKILAKLLPQYLDQDLYIVINGGVEETTELLKQRFDH
IFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRRITWGKYMNCGQT
CIAPDYILCEASLQNQIVWKIKETVKEFYGENIKESPDYERIINLRHFKRILSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPKTKVMQEEIFGPILPIVPVKNVDEAINFINEREKPLA
LYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFGGVGSSGMGAYHGKHSFDTFS
HQRPCLLKSLKREGANKLRYPPNSQSKVDWGKFFLLKRFNKEKLGLLLLTFLGIVAAVLV
KAEYY
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggagctcgaagtccggcgggtccgacaggcgttcctgtccggccggtcgcgacctctg
cggtttcggctgcagcagctggaggccctgcggaggatggtgcaggagcgcgagaaggat
atcctgacggccatcgccgccgacctgtgcaagagtgaattcaatgtgtacagtcaggaa
gtcattactgtccttggggaaattgattttatgcttgagaatcttcctgaatgggttact
gctaaaccagttaagaagaacgtgctcaccatgctggatgaggcctatattcagccacag
cctctgggagtggtgctgataatcggagcttggaattaccccttcgttctcaccattcag
ccactgataggagccatcgctgcaggaaatgctgtgattataaagccttctgaactgagt
gaaaatacagccaagatcttggcaaagcttctccctcagtatttagaccaggatctctat
attgttattaatggtggtgttgaggaaaccacggagctcctgaagcagcgatttgaccac
attttctatacgggaaacactgcggttggcaaaattgtcatggaagctgctgccaagcat
ctgacccctgtgactcttgaactgggagggaaaagtccatgttatattgataaagattgt
gacctggacattgtttgcagacgcataacctggggaaaatacatgaattgtggccaaacc
tgcattgcacccgactatattctctgtgaagcatccctccaaaatcaaattgtatggaag
attaaggaaacagtgaaggaattttatggagaaaatataaaagagtctcctgattatgaa
aggatcatcaatcttcgtcattttaagaggatactaagtttgcttgaaggacaaaagata
gcttttggtggggagactgatgaggccacacgctacatagccccaacagtacttaccgat
gttgatcctaaaaccaaggtgatgcaagaagaaatttttggaccaattcttccaatagtg
cctgtgaaaaatgtagatgaggccataaatttcataaatgaacgtgaaaagcctctggct
ctttatgtattttcgcataaccataagctcatcaaacggatgattgatgagacatccagt
ggaggtgtcacaggcaatgacgtcattatgcacttcacgctcaactctttcccatttgga
ggagtgggttccagtgggatgggagcttatcacggaaaacatagttttgatactttttct
catcagcgtccctgtttattaaaaagtttaaagagagaaggtgctaacaaactcagatat
cctcccaacagccagtcaaaggtggattggggaaaattttttctcttgaaacggttcaac
aaagaaaaactcggtctcctgttgctcactttcctgggtattgtagccgctgtgcttgtc
aaggcagaatattactga

DBGET integrated database retrieval system