KEGG   Homo sapiens (human): 2332Help
Entry
2332              CDS       T01001                                 

Gene name
FMR1, FMRP, FRAXA, POF, POF1
Definition
fragile X mental retardation 1
Orthology
K15516  
fragile X mental retardation protein
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Disease
H00465  
Fragile X Syndrome
H00627  
Premature ovarian failure
Class
Genetic Information Processing; Translation; RNA transport [PATH:hsa03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xq27.3
AA seq 537 aa AA seqDB search
MEELVVEVRGSNGAFYKAFVKDVHEDSITVAFENNWQPDRQIPFHDVRFPPPVGYNKDIN
ESDEVEVYSRANEKEPCCWWLAKVRMIKGEFYVIEYAACDATYNEIVTIERLRSVNPNKP
ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKR
AHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFHEQFIVREDLMGLAIGTHGAN
IQQARKVPGVTAIDLDEDTCTFHIYGEDQDAVKKARSFLEFAEDVIQVPRNLVGKVIGKN
GKLIQEIVDKSGVVRVRIEAENEKNVPQEEEIMPPNSLPSNNSRVGPNAPEEKKHLDIKE
NSTHFSQPNSTKVQRVLVASSVVAGESQKPELKAWQGMVPFVFVGTKDSIANATVLLDYH
LNYLKLQQRKRGRASCAEETDGGVEGEEEDKEEEDVEEASKETTITPEQIIVHVIQERLK
EEQQMDPFRSELTAIMKGVSTLKHYRIPPVKVVGCARVKIVTRRKRSQTAWMVSNHS
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggaggagctggtggtggaagtgcggggctccaatggcgctttctacaaggcatttgta
aaggatgttcatgaagattcaataacagttgcatttgaaaacaactggcagcctgatagg
cagattccatttcatgatgtcagattcccacctcctgtaggttataataaagatataaat
gaaagtgatgaagttgaggtgtattccagagcaaatgaaaaagagccttgctgttggtgg
ttagctaaagtgaggatgataaagggtgagttttatgtgatagaatatgcagcatgtgat
gcaacttacaatgaaattgtcacaattgaacgtctaagatctgttaatcccaacaaacct
gccacaaaagatactttccataagatcaagctggatgtgccagaagacttacggcaaatg
tgtgccaaagaggcggcacataaggattttaaaaaggcagttggtgccttttctgtaact
tatgatccagaaaattatcagcttgtcattttgtccatcaatgaagtcacctcaaagcga
gcacatatgctgattgacatgcactttcggagtctgcgcactaagttgtctctgataatg
agaaatgaagaagctagtaagcagctggagagttcaaggcagcttgcctcgagatttcat
gaacagtttatcgtaagagaagatctgatgggtctagctattggtactcatggtgctaat
attcagcaagctagaaaagtacctggggtcactgctattgatctagatgaagatacctgc
acatttcatatttatggagaggatcaggatgcagtgaaaaaagctagaagctttctcgaa
tttgctgaagatgtaatacaagttccaaggaacttagtaggcaaagtaataggaaaaaat
ggaaagctgattcaggagattgtggacaagtcaggagttgtgagggtgaggattgaggct
gaaaatgagaaaaatgttccacaagaagaggaaattatgccaccaaattcccttccttcc
aataattcaagggttggacctaatgccccagaagaaaaaaaacatttagatataaaggaa
aacagcacccatttttctcaacctaacagtacaaaagtccagagggtgttagtggcttca
tcagttgtagcaggggaatcccagaaacctgaactcaaggcttggcagggtatggtacca
tttgtttttgtgggaacaaaggacagcatcgctaatgccactgttcttttggattatcac
ctgaactatttaaagctccaacagaggaagagagggagagcttcctgcgcagaggagacg
gacggcggcgtggagggggaggaagaggacaaggaggaagaggacgtggaggaggcttca
aaggaaacgacgatcactcccgaacagataatcgtccacgtaatccaagagaggctaaag
gaagaacaacagatggatcccttcagatcagagttgactgcaataatgaaaggagtgtcc
acactaaaacattacagaatacctccagtgaaggtagtcggctgcgcacgggtaaagatc
gtaaccagaagaaagagaagccagacagcgtggatggtcagcaaccactcgtga

DBGET integrated database retrieval system