KEGG   Homo sapiens (human): 2719Help
Entry
2719              CDS       T01001                                 

Gene name
GPC3, DGSX, GTR2-2, MXR7, OCI-5, SDYS, SGB, SGBS, SGBS1
Definition
(RefSeq) glypican 3
  KO
K08109  
glypican 3
Organism
hsa  Homo sapiens (human)
Pathway
Proteoglycans in cancer
Disease
H00493  
Heparan sulfate proteoglycan gene defects
H01215  
Simpson-Golabi-Behmel syndrome (SGBS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2719 (GPC3)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2719 (GPC3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2719 (GPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xq26.1
AA seq 580 aa AA seqDB search
MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPK
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQ
QATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaccgtgcgcaccgcgtgcttggtggtggcgatgctgctcagcttggacttc
ccgggacaggcgcagcccccgccgccgccgccggacgccacctgtcaccaagtccgctcc
ttcttccagagactgcagcccggactcaagtgggtgccagaaactcccgtgccaggatca
gatttgcaagtatgtctccctaagggcccaacatgctgctcaagaaagatggaagaaaaa
taccaactaacagcacgattgaacatggaacagctgcttcagtctgcaagtatggagctc
aagttcttaattattcagaatgctgcggttttccaagaggcctttgaaattgttgttcgc
catgccaagaactacaccaatgccatgttcaagaacaactacccaagcctgactccacaa
gcttttgagtttgtgggtgaatttttcacagatgtgtctctctacatcttgggttctgac
atcaatgtagatgacatggtcaatgaattgtttgacagcctgtttccagtcatctatacc
cagctaatgaacccaggcctgcctgattcagccttggacatcaatgagtgcctccgagga
gcaagacgtgacctgaaagtatttgggaatttccccaagcttattatgacccaggtttcc
aagtcactgcaagtcactaggatcttccttcaggctctgaatcttggaattgaagtgatc
aacacaactgatcacctgaagttcagtaaggactgtggccgaatgctcaccagaatgtgg
tactgctcttactgccagggactgatgatggttaaaccctgtggcggttactgcaatgtg
gtcatgcaaggctgtatggcaggtgtggtggagattgacaagtactggagagaatacatt
ctgtcccttgaagaacttgtgaatggcatgtacagaatctatgacatggagaacgtactg
cttggtctcttttcaacaatccatgattctatccagtatgtccagaagaatgcaggaaag
ctgaccaccactattggcaagttatgtgcccattctcaacaacgccaatatagatctgct
tattatcctgaagatctctttattgacaagaaagtattaaaagttgctcatgtagaacat
gaagaaaccttatccagccgaagaagggaactaattcagaagttgaagtctttcatcagc
ttctatagtgctttgcctggctacatctgcagccatagccctgtggcggaaaacgacacc
ctttgctggaatggacaagaactcgtggagagatacagccaaaaggcagcaaggaatgga
atgaaaaaccagttcaatctccatgagctgaaaatgaagggccctgagccagtggtcagt
caaattattgacaaactgaagcacattaaccagctcctgagaaccatgtctatgcccaaa
ggtagagttctggataaaaacctggatgaggaagggtttgaaagtggagactgcggtgat
gatgaagatgagtgcattggaggctctggtgatggaatgataaaagtgaagaatcagctc
cgcttccttgcagaactggcctatgatctggatgtggatgatgcgcctggaaacagtcag
caggcaactccgaaggacaacgagataagcacctttcacaacctcgggaacgttcattcc
ccgctgaagcttctcaccagcatggccatctcggtggtgtgcttcttcttcctggtgcac
tga

DBGET integrated database retrieval system