KEGG   Homo sapiens (human): 494513Help
Entry
494513            CDS       T01001                                 

Gene name
DFNB59, PJVK
Definition
deafness, autosomal recessive 59
Organism
hsa  Homo sapiens (human)
Disease
H00605  
Deafness, autosomal recessive
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
2q31.2
AA seq 352 aa AA seqDB search
MFAAATKSFVKQVGDGGRLVPVPSLSEADKYQPLSLVVKKKRCFLFPRYKFTSTPFTLKD
ILLGDREISAGISSYQLLNYEDESDVSLYGRRGNHIVNDVGINVAGSDSIAVKASFGIVT
KHEVEVSTLLKEITTRKINFDHSLIRQSRSSRKAVLCVVMESIRTTRQCSLSVHAGIRGE
AMRFHFMDEQNPKGRDKAIVFPAHTTIAFSVFELFIYLDGAFDLCVTSVSKGGFEREETA
TFALLYRLRNILFERNRRVMDVISRSQLYLDDLFSDYYDKPLSMTDISLKEGTHIRVNLL
NHNIPKGPCILCGMGNFKRETVYGCFQCSVDGQKYVRLHAVPCFDIWHKRMK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtttgctgctgctaccaagagctttgtcaagcaagttggagatggagggagattagtt
cctgttccaagcctcagtgaagctgacaaatatcaacctctaagtctggtggtaaaaaag
aagcgatgctttctgtttcctagatataaatttacttcaacaccttttacactgaaagat
attctcctaggagacagagaaatttcagctggtatttcatcttatcaattactgaattat
gaagatgaatcagatgtttcactctatggaaggcgaggtaaccatattgtaaatgacgtt
gggattaacgttgctggatcagattccattgcagtgaaagcttcatttggtatagtaacc
aaacatgaagtggaagtatcaacattactcaaagaaattactacacgaaaaattaacttt
gaccacagcttgatacgtcagtcaaggagcagcagaaaggcagtattgtgtgtggtcatg
gagagcatccgaaccacacgacagtgctcactgtctgtgcatgctggaattcgaggggaa
gcaatgcggtttcactttatggatgaacagaatcccaagggaagggacaaagctattgtt
ttcccagcacatacaaccatagctttcagtgtttttgaactcttcatatacctggatggt
gcctttgacctttgtgtcacttcagtgtcaaaaggaggatttgaaagggaagaaacggca
acatttgcactgctgtacaggttgagaaatatcctatttgaaagaaatagaagagtgatg
gatgtcatttctcgttcacagctttacttggatgatcttttttctgactactatgacaaa
cctctcagcatgactgatatttcactcaaagaagggacccatatccgagttaacttactt
aatcacaacattcccaaagggccttgcatactctgtggaatggggaacttcaaaagggag
acagtttatgggtgctttcagtgttctgttgatggtcagaagtatgtgagacttcatgca
gttccttgttttgatatttggcacaagaggatgaaataa

DBGET integrated database retrieval system