KEGG   Homo sapiens (human): 6687Help
Entry
6687              CDS       T01001                                 

Gene name
SPG7, CAR, CMAR, PGN, SPG5C
Definition
spastic paraplegia 7 (pure and complicated autosomal recessive)
Orthology
K09552  
spastic paraplegia 7 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Disease
H00266  
Hereditary spastic paraplegia (SPG)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16q24.3
AA seq 795 aa AA seqDB search
MAVLLLLLRALRRGPGPGPRPLWGPGPAWSPGFPARPGRGRPYMASRPPGDLAEAGGRAL
QSLQLRLLTPTFEGINGLLLKQHLVQNPVRLWQLLGGTFYFNTSRLKQKNKEKDKSKGKA
PEEDEEERRRRERDDQMYRERLRTLLVIAVVMSLLNALSTSGGSISWNDFVHEMLAKGEV
QRVQVVPESDVVEVYLHPGAVVFGRPRLALMYRMQVANIDKFEEKLRAAEDELNIEAKDR
IPVSYKRTGFFGNALYSVGMTAVGLAILWYVFRLAGMTGREGGFSAFNQLKMARFTIVDG
KMGKGVSFKDVAGMHEAKLEVREFVDYLKSPERFLQLGAKVPKGALLLGPPGCGKTLLAK
AVATEAQVPFLAMAGPEFVEVIGGLGAARVRSLFKEARARAPCIVYIDEIDAVGKKRSTT
MSGFSNTEEEQTLNQLLVEMDGMGTTDHVIVLASTNRADILDGALMRPGRLDRHVFIDLP
TLQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGFSGADIANICNEAALHAAREGHTSV
HTLNFEYAVERVLAGTAKKSKILSKEEQKVVAFHESGHALVGWMLEHTEAVMKVSITPRT
NAALGFAQMLPRDQHLFTKEQLFERMCMALGGRASEALSFNEVTSGAQDDLRKVTRIAYS
MVKQFGMAPGIGPISFPEAQEGLMGIGRRPFSQGLQQMMDHEARLLVAKAYRHTEKVLQD
NLDKLQALANALLEKEVINYEDIEALIGPPPHGPKKMIAPQRWIDAQREKQDLGEEETEE
TQQPPLGGEEPTWPK
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgctgctgctgctgctccgtgccctccgccggggtccaggcccgggtcctcgg
ccgctgtggggcccaggcccggcctggagtccagggttccccgccaggcccgggaggggg
cggccgtacatggccagcaggcctccgggggacctcgccgaggctggaggccgagctctg
cagagcttacaattgagactgctaacccctacctttgaagggatcaacggattgttgttg
aaacaacatttagttcagaatccagtcagactctggcaacttttaggtggtactttctat
tttaacacctcaaggttgaagcagaagaataaggagaaggataagtcgaaggggaaggcg
cctgaagaggacgaagaggagaggagacgccgtgagcgggacgaccagatgtaccgagag
cggctgcgcaccttgctggtcatcgcggttgtcatgagcctcctgaatgctctcagcacc
agcggaggcagcatttcctggaacgactttgtccacgagatgctggccaagggcgaggtg
cagcgcgtccaggtggtgcctgagagcgacgtggtggaagtctacctgcaccctggagcc
gtggtgtttgggcggcctcggctagccttgatgtaccgaatgcaggttgcaaatattgac
aagtttgaagagaagcttcgagcagctgaagatgagctgaatatcgaggccaaggacagg
atcccagtttcctacaagcgaacaggattctttggaaatgccctgtactctgtggggatg
acggcagtgggcctggccatcctgtggtatgttttccgtctggccgggatgactggaagg
gaaggtggattcagtgcttttaatcagcttaaaatggctcgtttcaccattgtggatggg
aagatggggaaaggagtcagcttcaaagacgtggcaggaatgcacgaagccaaactggaa
gtccgcgagtttgtggattatctgaagagcccagaacgcttcctccagcttggcgccaag
gtcccaaagggcgcactgctgctcggcccccccggctgtgggaagacgctgctggccaag
gcggtggccacggaggctcaggtgcccttcctggcgatggccggcccagagttcgtggag
gtcattggaggcctcggcgctgcccgtgtgcggagcctctttaaggaagcccgagcccgg
gccccctgcatcgtctacatcgatgagatcgacgcggtgggcaagaagcgctccaccacc
atgtccggcttctccaacacggaggaggagcagacgctcaaccagcttctggtagaaatg
gatggaatgggtaccacagaccatgtcatcgtcctggcgtccacgaaccgagctgacatt
ttggacggtgctctgatgaggccaggccgactggaccggcacgtcttcattgatctcccc
acgctgcaggagaggcgggagatttttgagcagcacctgaagagcctgaagctgacccag
tccagcaccttttactcccagcgtctggcagagctgacaccaggattcagtggggctgac
atcgccaacatctgcaatgaggctgcgctgcacgcggcgcgggagggacacacttccgtg
cacactctcaacttcgagtacgccgtggagcgcgtcctcgcagggactgccaaaaagagc
aagatcctgtccaaggaagaacagaaagtggttgcgtttcatgagtcgggccacgccttg
gtgggctggatgctggagcacacggaggccgtgatgaaggtctccataacccctcggaca
aacgccgccctgggctttgctcagatgctccccagagaccagcacctcttcaccaaggag
cagctgtttgagcggatgtgcatggccctgggaggacgggcctcggaagcactgtccttc
aacgaggtcacttctggggcacaggacgacctgaggaaggtcacccgcatcgcctactcc
atggtgaagcagtttgggatggcacctggcatcgggcccatctccttccctgaggcgcag
gagggcctcatgggcatcgggcggcgccccttcagccaaggcctgcagcagatgatggac
catgaagcaagactgctggtggccaaggcctacagacacaccgagaaggtgctgcaggac
aacctggacaagttgcaggcgctggcaaacgcccttctggaaaaggaagtgataaactat
gaggacattgaggctctcattggcccgccgccccatgggccgaagaaaatgatcgcaccg
cagaggtggatcgacgcccagagggagaaacaggacttgggcgaggaggagaccgaagag
acccagcagcctccacttggaggcgaagagccgacttggcccaagtag

DBGET integrated database retrieval system