KEGG   Homo sapiens (human): 7305Help
Entry
7305              CDS       T01001                                 

Gene name
TYROBP, DAP12, KARAP, PLOSL
Definition
TYRO protein tyrosine kinase binding protein
Orthology
K07992  
TYRO protein tyrosine kinase binding protein
Organism
hsa  Homo sapiens (human)
Pathway
Osteoclast differentiation
Natural killer cell mediated cytotoxicity
Disease
H00438  
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL)
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
Organismal Systems; Development; Osteoclast differentiation [PATH:hsa04380]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13.1
AA seq 102 aa AA seqDB search
MGGLEPCSRLLLLPLLLAVSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRG
RGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atggggggacttgaaccctgcagcaggctcctgctcctgcctctcctgctggctgtaagt
gattgcagttgctctacggtgagcccgggcgtgctggcagggatcgtgatgggagacctg
gtgctgacagtgctcattgccctggccgtgtacttcctgggccggctggtccctcggggg
cgaggggctgcggaggcagcgacccggaaacagcgtatcactgagaccgagtcgccttat
caggagctccagggtcagaggtcggatgtctacagcgacctcaacacacagaggccgtat
tacaaatga

DBGET integrated database retrieval system