KEGG   Homo sapiens (human): 10000Help
Entry
10000             CDS       T01001                                 

Gene name
AKT3, MPPH, PKB-GAMMA, PKBG, PRKBG, RAC-PK-gamma, RAC-gamma, STK-2
Definition
v-akt murine thymoma viral oncogene homolog 3 (EC:2.7.11.1)
Orthology
K04456  
RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Apoptosis
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Tight junction
Platelet activation
Toll-like receptor signaling pathway
Jak-STAT signaling pathway
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Neurotrophin signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Carbohydrate digestion and absorption
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Measles
Influenza A
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Melanoma
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    10000 (AKT3)
   04015 Rap1 signaling pathway
    10000 (AKT3)
   04010 MAPK signaling pathway
    10000 (AKT3)
   04012 ErbB signaling pathway
    10000 (AKT3)
   04370 VEGF signaling pathway
    10000 (AKT3)
   04630 Jak-STAT signaling pathway
    10000 (AKT3)
   04668 TNF signaling pathway
    10000 (AKT3)
   04066 HIF-1 signaling pathway
    10000 (AKT3)
   04068 FoxO signaling pathway
    10000 (AKT3)
   04024 cAMP signaling pathway
    10000 (AKT3)
   04022 cGMP - PKG signaling pathway
    10000 (AKT3)
   04151 PI3K-Akt signaling pathway
    10000 (AKT3)
   04152 AMPK signaling pathway
    10000 (AKT3)
   04150 mTOR signaling pathway
    10000 (AKT3)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    10000 (AKT3)
  Cell communication
   04510 Focal adhesion
    10000 (AKT3)
   04530 Tight junction
    10000 (AKT3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    10000 (AKT3)
   04620 Toll-like receptor signaling pathway
    10000 (AKT3)
   04660 T cell receptor signaling pathway
    10000 (AKT3)
   04662 B cell receptor signaling pathway
    10000 (AKT3)
   04664 Fc epsilon RI signaling pathway
    10000 (AKT3)
   04666 Fc gamma R-mediated phagocytosis
    10000 (AKT3)
   04062 Chemokine signaling pathway
    10000 (AKT3)
  Endocrine system
   04910 Insulin signaling pathway
    10000 (AKT3)
   04920 Adipocytokine signaling pathway
    10000 (AKT3)
   04915 Estrogen signaling pathway
    10000 (AKT3)
   04914 Progesterone-mediated oocyte maturation
    10000 (AKT3)
   04917 Prolactin signaling pathway
    10000 (AKT3)
   04919 Thyroid hormone signaling pathway
    10000 (AKT3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10000 (AKT3)
  Digestive system
   04973 Carbohydrate digestion and absorption
    10000 (AKT3)
  Nervous system
   04725 Cholinergic synapse
    10000 (AKT3)
   04728 Dopaminergic synapse
    10000 (AKT3)
   04722 Neurotrophin signaling pathway
    10000 (AKT3)
  Development
   04380 Osteoclast differentiation
    10000 (AKT3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10000 (AKT3)
   05205 Proteoglycans in cancer
    10000 (AKT3)
   05210 Colorectal cancer
    10000 (AKT3)
   05212 Pancreatic cancer
    10000 (AKT3)
   05214 Glioma
    10000 (AKT3)
   05221 Acute myeloid leukemia
    10000 (AKT3)
   05220 Chronic myeloid leukemia
    10000 (AKT3)
   05218 Melanoma
    10000 (AKT3)
   05211 Renal cell carcinoma
    10000 (AKT3)
   05215 Prostate cancer
    10000 (AKT3)
   05213 Endometrial cancer
    10000 (AKT3)
   05222 Small cell lung cancer
    10000 (AKT3)
   05223 Non-small cell lung cancer
    10000 (AKT3)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    10000 (AKT3)
  Infectious diseases
   05152 Tuberculosis
    10000 (AKT3)
   05166 HTLV-I infection
    10000 (AKT3)
   05162 Measles
    10000 (AKT3)
   05164 Influenza A
    10000 (AKT3)
   05161 Hepatitis B
    10000 (AKT3)
   05160 Hepatitis C
    10000 (AKT3)
   05169 Epstein-Barr virus infection
    10000 (AKT3)
   05145 Toxoplasmosis
    10000 (AKT3)
   05142 Chagas disease (American trypanosomiasis)
    10000 (AKT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     10000 (AKT3)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: AGC group
  AKT family
   10000 (AKT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q44
AA seq 465 aa AA seqDB search
MSDVTIVKEGWVQKRGEYIKNWRPRYFLLKTDGSFIGYKEKPQDVDLPYPLNNFSVAKCQ
LMKTERPKPNTFIIRCLQWTTVIERTFHVDTPEEREEWTEAIQAVADRLQRQEEERMNCS
PTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILK
KEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRE
RVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDA
ATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILM
EDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVP
PFKPQVTSETDTRYFDEEFTAQTITITPPEKCQQSDCGMLGNWKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgttaccattgtgaaagaaggttgggttcagaagaggggagaatatataaaa
aactggaggccaagatacttccttttgaagacagatggctcattcataggatataaagag
aaacctcaagatgtggatttaccttatcccctcaacaacttttcagtggcaaaatgccag
ttaatgaaaacagaacgaccaaagccaaacacatttataatcagatgtctccagtggact
actgttatagagagaacatttcatgtagatactccagaggaaagggaagaatggacagaa
gctatccaggctgtagcagacagactgcagaggcaagaagaggagagaatgaattgtagt
ccaacttcacaaattgataatataggagaggaagagatggatgcctctacaacccatcat
aaaagaaagacaatgaatgattttgactatttgaaactactaggtaaaggcacttttggg
aaagttattttggttcgagagaaggcaagtggaaaatactatgctatgaagattctgaag
aaagaagtcattattgcaaaggatgaagtggcacacactctaactgaaagcagagtatta
aagaacactagacatccctttttaacatccttgaaatattccttccagacaaaagaccgt
ttgtgttttgtgatggaatatgttaatgggggcgagctgtttttccatttgtcgagagag
cgggtgttctctgaggaccgcacacgtttctatggtgcagaaattgtctctgccttggac
tatctacattccggaaagattgtgtaccgtgatctcaagttggagaatctaatgctggac
aaagatggccacataaaaattacagattttggactttgcaaagaagggatcacagatgca
gccaccatgaagacattctgtggcactccagaatatctggcaccagaggtgttagaagat
aatgactatggccgagcagtagactggtggggcctaggggttgtcatgtatgaaatgatg
tgtgggaggttacctttctacaaccaggaccatgagaaactttttgaattaatattaatg
gaagacattaaatttcctcgaacactctcttcagatgcaaaatcattgctttcagggctc
ttgataaaggatccaaataaacgccttggtggaggaccagatgatgcaaaagaaattatg
agacacagtttcttctctggagtaaactggcaagatgtatatgataaaaagcttgtacct
ccttttaaacctcaagtaacatctgagacagatactagatattttgatgaagaatttaca
gctcagactattacaataacaccacctgaaaaatgtcagcaatcagattgtggcatgctg
ggtaactggaaaaaataa

DBGET integrated database retrieval system