KEGG   Homo sapiens (human): 10057Help
Entry
10057             CDS       T01001                                 

Gene name
ABCC5, ABC33, EST277145, MOAT-C, MOATC, MRP5, SMRP, pABC11
Definition
(RefSeq) ATP binding cassette subfamily C member 5
  KO
K05668  
ATP-binding cassette, subfamily C (CFTR/MRP), member 5
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    10057 (ABCC5)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    10057 (ABCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q27
AA seq 1437 aa AA seqDB search
MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLS
LDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLAR
VAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLI
LSIVCLMITQLAGFSGPAFMVKHLLEYTQATESNLQYSLLLVLGLLLTEIVRSWSLALTW
ALNYRTGVRLRGAILTMAFKKILKLKNIKEKSLGELINICSNDGQRMFEAAAVGSLLAGG
PVVAILGMIYNVIILGPTGFLGSAVFILFYPAMMFASRLTAYFRRKCVAATDERVQKMNE
VLTYIKFIKMYAWVKAFSQSVQKIREEERRILEKAGYFQSITVGVAPIVVVIASVVTFSV
HMTLGFDLTAAQAFTVVTVFNSMTFALKVTPFSVKSLSEASVAVDRFKSLFLMEEVHMIK
NKPASPHIKIEMKNATLAWDSSHSSIQNSPKLTPKMKKDKRASRGKKEKVRQLQRTEHQA
VLAEQKGHLLLDSDERPSPEEEEGKHIHLGHLRLQRTLHSIDLEIQEGKLVGICGSVGSG
KTSLISAILGQMTLLEGSIAISGTFAYVAQQAWILNATLRDNILFGKEYDEERYNSVLNS
CCLRPDLAILPSSDLTEIGERGANLSGGQRQRISLARALYSDRSIYILDDPLSALDAHVG
NHIFNSAIRKHLKSKTVLFVTHQLQYLVDCDEVIFMKEGCITERGTHEELMNLNGDYATI
FNNLLLGETPPVEINSKKETSGSQKKSQDKGPKTGSVKKEKAVKPEEGQLVQLEEKGQGS
VPWSVYGVYIQAAGGPLAFLVIMALFMLNVGSTAFSTWWLSYWIKQGSGNTTVTRGNETS
VSDSMKDNPHMQYYASIYALSMAVMLILKAIRGVVFVKGTLRASSRLHDELFRRILRSPM
KFFDTTPTGRILNRFSKDMDEVDVRLPFQAEMFIQNVILVFFCVGMIAGVFPWFLVAVGP
LVILFSVLHIVSRVLIRELKRLDNITQSPFLSHITSSIQGLATIHAYNKGQEFLHRYQEL
LDDNQAPFFLFTCAMRWLAVRLDLISIALITTTGLMIVLMHGQIPPAYAGLAISYAVQLT
GLFQFTVRLASETEARFTSVERINHYIKTLSLEAPARIKNKAPSPDWPQEGEVTFENAEM
RYRENLPLVLKKVSFTIKPKEKIGIVGRTGSGKSSLGMALFRLVELSGGCIKIDGVRISD
IGLADLRSKLSIIPQEPVLFSGTVRSNLDPFNQYTEDQIWDALERTHMKECIAQLPLKLE
SEVMENGDNFSVGERQLLCIARALLRHCKILILDEATAAMDTETDLLIQETIREAFADCT
MLTIAHRLHTVLGSDRIMVLAQGQVVEFDTPSVLLSNDSSRFYAMFAAAENKVAVKG
NT seq 4314 nt NT seq  +upstreamnt  +downstreamnt
atgaaggatatcgacataggaaaagagtatatcatccccagtcctgggtatagaagtgtg
agggagagaaccagcacttctgggacgcacagagaccgtgaagattccaagttcaggaga
actcgaccgttggaatgccaagatgccttggaaacagcagcccgagccgagggcctctct
cttgatgcctccatgcattctcagctcagaatcctggatgaggagcatcccaagggaaag
taccatcatggcttgagtgctctgaagcccatccggactacttccaaacaccagcaccca
gtggacaatgctgggcttttttcctgtatgactttttcgtggctttcttctctggcccgt
gtggcccacaagaagggggagctctcaatggaagacgtgtggtctctgtccaagcacgag
tcttctgacgtgaactgcagaagactagagagactgtggcaagaagagctgaatgaagtt
gggccagacgctgcttccctgcgaagggttgtgtggatcttctgccgcaccaggctcatc
ctgtccatcgtgtgcctgatgatcacgcagctggctggcttcagtggaccagccttcatg
gtgaaacacctcttggagtatacccaggcaacagagtctaacctgcagtacagcttgttg
ttagtgctgggcctcctcctgacggaaatcgtgcggtcttggtcgcttgcactgacttgg
gcattgaattaccgaaccggtgtccgcttgcggggggccatcctaaccatggcatttaag
aagatccttaagttaaagaacattaaagagaaatccctgggtgagctcatcaacatttgc
tccaacgatgggcagagaatgtttgaggcagcagccgttggcagcctgctggctggagga
cccgttgttgccatcttaggcatgatttataatgtaattattctgggaccaacaggcttc
ctgggatcagctgtttttatcctcttttacccagcaatgatgtttgcatcacggctcaca
gcatatttcaggagaaaatgcgtggccgccacggatgaacgtgtccagaagatgaatgaa
gttcttacttacattaaatttatcaaaatgtatgcctgggtcaaagcattttctcagagt
gttcaaaaaatccgcgaggaggagcgtcggatattggaaaaagctgggtacttccagagc
atcactgtgggtgtggctcccattgtggtggtgattgccagcgtggtgaccttctctgtt
catatgaccctgggcttcgatctgacagcagcacaggctttcacagtggtgacagtcttc
aattccatgacttttgctttgaaagtaacaccgttttcagtaaagtccctctcagaagcc
tcagtggctgttgacagatttaagagtttgtttctaatggaagaggttcacatgataaag
aacaaaccagccagtcctcacatcaagatagagatgaaaaatgccaccttggcatgggac
tcctcccactccagtatccagaactcgcccaagctgacccccaaaatgaaaaaagacaag
agggcttccaggggcaagaaagagaaggtgaggcagctgcagcgcactgagcatcaggcg
gtgctggcagagcagaaaggccacctcctcctggacagtgacgagcggcccagtcccgaa
gaggaagaaggcaagcacatccacctgggccacctgcgcttacagaggacactgcacagc
atcgatctggagatccaagagggtaaactggttggaatctgtggcagtgtgggaagtgga
aaaacctctctcatttcagccattttaggccagatgacgcttctagagggcagcattgca
atcagtggaaccttcgcttatgtggcccagcaggcctggatcctcaatgctactctgaga
gacaacatcctgtttgggaaggaatatgatgaagaaagatacaactctgtgctgaacagc
tgctgcctgaggcctgacctggccattcttcccagcagcgacctgacggagattggagag
cgaggagccaacctgagcggtgggcagcgccagaggatcagccttgcccgggccttgtat
agtgacaggagcatctacatcctggacgaccccctcagtgccttagatgcccatgtgggc
aaccacatcttcaatagtgctatccggaaacatctcaagtccaagacagttctgtttgtt
acccaccagttacagtacctggttgactgtgatgaagtgatcttcatgaaagagggctgt
attacggaaagaggcacccatgaggaactgatgaatttaaatggtgactatgctaccatt
tttaataacctgttgctgggagagacaccgccagttgagatcaattcaaaaaaggaaacc
agtggttcacagaagaagtcacaagacaagggtcctaaaacaggatcagtaaagaaggaa
aaagcagtaaagccagaggaagggcagcttgtgcagctggaagagaaagggcagggttca
gtgccctggtcagtatatggtgtctacatccaggctgctgggggccccttggcattcctg
gttattatggcccttttcatgctgaatgtaggcagcaccgccttcagcacctggtggttg
agttactggatcaagcaaggaagcgggaacaccactgtgactcgagggaacgagacctcg
gtgagtgacagcatgaaggacaatcctcatatgcagtactatgccagcatctacgccctc
tccatggcagtcatgctgatcctgaaagccattcgaggagttgtctttgtcaagggcacg
ctgcgagcttcctcccggctgcatgacgagcttttccgaaggatccttcgaagccctatg
aagttttttgacacgacccccacagggaggattctcaacaggttttccaaagacatggat
gaagttgacgtgcggctgccgttccaggccgagatgttcatccagaacgttatcctggtg
ttcttctgtgtgggaatgatcgcaggagtcttcccgtggttccttgtggcagtggggccc
cttgtcatcctcttttcagtcctgcacattgtctccagggtcctgattcgggagctgaag
cgtctggacaatatcacgcagtcacctttcctctcccacatcacgtccagcatacagggc
cttgccaccatccacgcctacaataaagggcaggagtttctgcacagataccaggagctg
ctggatgacaaccaagctcctttttttttgtttacgtgtgcgatgcggtggctggctgtg
cggctggacctcatcagcatcgccctcatcaccaccacggggctgatgatcgttcttatg
cacgggcagattcccccagcctatgcgggtctcgccatctcttatgctgtccagttaacg
gggctgttccagtttacggtcagactggcatctgagacagaagctcgattcacctcggtg
gagaggatcaatcactacattaagactctgtccttggaagcacctgccagaattaagaac
aaggctccctcccctgactggccccaggagggagaggtgacctttgagaacgcagagatg
aggtaccgagaaaacctccctctcgtcctaaagaaagtatccttcacgatcaaacctaaa
gagaagattggcattgtggggcggacaggatcagggaagtcctcgctggggatggccctc
ttccgtctggtggagttatctggaggctgcatcaagattgatggagtgagaatcagtgat
attggccttgccgacctccgaagcaaactctctatcattcctcaagagccggtgctgttc
agtggcactgtcagatcaaatttggaccccttcaaccagtacactgaagaccagatttgg
gatgccctggagaggacacacatgaaagaatgtattgctcagctacctctgaaacttgaa
tctgaagtgatggagaatggggataacttctcagtgggggaacggcagctcttgtgcata
gctagagccctgctccgccactgtaagattctgattttagatgaagccacagctgccatg
gacacagagacagacttattgattcaagagaccatccgagaagcatttgcagactgtacc
atgctgaccattgcccatcgcctgcacacggttctaggctccgataggattatggtgctg
gcccagggacaggtggtggagtttgacaccccatcggtccttctgtccaacgacagttcc
cgattctatgccatgtttgctgctgcagagaacaaggtcgctgtcaagggctga

DBGET integrated database retrieval system