KEGG   Homo sapiens (human): 10095Help
Entry
10095             CDS       T01001                                 

Gene name
ARPC1B, ARC41, p40-ARC, p41-ARC
Definition
actin related protein 2/3 complex, subunit 1B, 41kDa
Orthology
K05757  
actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10095 (ARPC1B)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10095 (ARPC1B)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10095 (ARPC1B)
   05132 Salmonella infection
    10095 (ARPC1B)
   05131 Shigellosis
    10095 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    10095 (ARPC1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 372 aa AA seqDB search
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATL
ASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagattgccatctgccccaacaaccatgaggtgcatatctatgaaaagagcggtgcc
aaatggaccaaggtgcacgagctcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgtattgtgacctgcggcacagaccgcaacgcctacgtgtggacg
ctgaagggccgcacatggaagcccacgctggtcatcctgcggatcaaccgggctgcccgc
tgcgtgcgctgggcccccaacgagaacaagtttgctgtgggcagcggctctcgtgtgatc
tccatctgttatttcgagcaggagaatgactggtgggtttgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaatgtgctgctggctgccggc
tcctgtgacttcaagtgtcggatcttttcagcctacatcaaggaggtggaggaacggccg
gcacccaccccgtggggctccaagatgccctttggggaactgatgttcgaatccagcagt
agctgcggctgggtacatggcgtctgtttctcagccagcgggagccgcgtggcctgggta
agccacgacagcaccgtctgcctggctgatgccgacaagaagatggccgtcgcgactctg
gcctctgaaacactaccactgctggcgctgaccttcatcacagacaacagcctggtggca
gcgggccacgactgcttcccggtgctgttcacctatgacgccgccgcggggatgctgagc
ttcggcgggcggctggacgttcctaagcagagctcgcagcgtggcttgacggcccgcgag
cgcttccagaacctggacaagaaggcgagctccgagggtggcacggctgcgggcgcgggc
ctagactcgctgcacaagaacagcgtcagccagatctcggtgctcagcggcggcaaggcc
aagtgctcgcagttctgcaccactggcatggatggcggcatgagtatctgggatgtgaag
agcttggagtcagccttgaaggacctcaagatcaaatga

DBGET integrated database retrieval system