KEGG   Homo sapiens (human): 10095Help
Entry
10095             CDS       T01001                                 

Gene name
ARPC1B, ARC41, PLTEID, p40-ARC, p41-ARC
Definition
(RefSeq) actin related protein 2/3 complex subunit 1B
  KO
K05757  actin related protein 2/3 complex, subunit 1A/1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    10095 (ARPC1B)
  Cell motility
   04810 Regulation of actin cytoskeleton
    10095 (ARPC1B)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    10095 (ARPC1B)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10095 (ARPC1B)
   05132 Salmonella infection
    10095 (ARPC1B)
   05131 Shigellosis
    10095 (ARPC1B)
   05100 Bacterial invasion of epithelial cells
    10095 (ARPC1B)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10095 (ARPC1B)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10095 (ARPC1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 eIF2A
Motif
Other DBs
NCBI-GeneID: 10095
NCBI-ProteinID: NP_005711
OMIM: 604223
HGNC: 704
Ensembl: ENSG00000130429
Vega: OTTHUMG00000154552
Pharos: O15143(Tbio)
UniProt: O15143 A4D275
Position
7q22.1
AA seq 372 aa AA seqDB search
MAYHSFLVEPISCHAWNKDRTQIAICPNNHEVHIYEKSGAKWTKVHELKEHNGQVTGIDW
APESNRIVTCGTDRNAYVWTLKGRTWKPTLVILRINRAARCVRWAPNENKFAVGSGSRVI
SICYFEQENDWWVCKHIKKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERP
APTPWGSKMPFGELMFESSSSCGWVHGVCFSASGSRVAWVSHDSTVCLADADKKMAVATL
ASETLPLLALTFITDNSLVAAGHDCFPVLFTYDAAAGMLSFGGRLDVPKQSSQRGLTARE
RFQNLDKKASSEGGTAAGAGLDSLHKNSVSQISVLSGGKAKCSQFCTTGMDGGMSIWDVK
SLESALKDLKIK
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcctaccacagcttcctggtggagcccatcagctgccacgcctggaacaaggaccgc
acccagattgccatctgccccaacaaccatgaggtgcatatctatgaaaagagcggtgcc
aaatggaccaaggtgcacgagctcaaggagcacaacgggcaggtgacaggcatcgactgg
gcccccgagagtaaccgtattgtgacctgcggcacagaccgcaacgcctacgtgtggacg
ctgaagggccgcacatggaagcccacgctggtcatcctgcggatcaaccgggctgcccgc
tgcgtgcgctgggcccccaacgagaacaagtttgctgtgggcagcggctctcgtgtgatc
tccatctgttatttcgagcaggagaatgactggtgggtttgcaagcacatcaagaagccc
atccgctccaccgtcctcagcctggactggcaccccaacaatgtgctgctggctgccggc
tcctgtgacttcaagtgtcggatcttttcagcctacatcaaggaggtggaggaacggccg
gcacccaccccgtggggctccaagatgccctttggggaactgatgttcgaatccagcagt
agctgcggctgggtacatggcgtctgtttctcagccagcgggagccgcgtggcctgggta
agccacgacagcaccgtctgcctggctgatgccgacaagaagatggccgtcgcgactctg
gcctctgaaacactaccactgctggcgctgaccttcatcacagacaacagcctggtggca
gcgggccacgactgcttcccggtgctgttcacctatgacgccgccgcggggatgctgagc
ttcggcgggcggctggacgttcctaagcagagctcgcagcgtggcttgacggcccgcgag
cgcttccagaacctggacaagaaggcgagctccgagggtggcacggctgcgggcgcgggc
ctagactcgctgcacaagaacagcgtcagccagatctcggtgctcagcggcggcaaggcc
aagtgctcgcagttctgcaccactggcatggatggcggcatgagtatctgggatgtgaag
agcttggagtcagccttgaaggacctcaagatcaaatga

DBGET integrated database retrieval system