KEGG   Homo sapiens (human): 10130Help
Entry
10130             CDS       T01001                                 

Gene name
PDIA6, ERP5, P5, TXNDC7
Definition
(RefSeq) protein disulfide isomerase family A member 6
  KO
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    10130 (PDIA6)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     10130 (PDIA6)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Protein disulfide isomerase
   10130 (PDIA6)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    10130 (PDIA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25.1
AA seq 440 aa AA seqDB search
MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQR
LTPEWKKAATALKDVVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTG
EAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDKNVLDSEDV
WMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTI
KIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVA
VLPHILDTGAAGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMA
AINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELP
VEDDIDLSDVELDDLGKDEL
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctctcctggtgctcggtctggtgagctgtaccttctttctggcagtgaatggtctg
tattcctctagtgatgatgtgatcgaattaactccatcgaatttcaaccgagaagttatt
cagagtgatagtttgtggcttgtagaattctatgctccatggtgtggtcactgtcaaaga
ttaacaccagaatggaagaaagcagcaactgcattaaaagatgttgtcaaagttggtgca
gttgatgcagataagcatcattccctaggaggtcagtatggtgttcagggatttcctacc
attaagatttttggatccaacaaaaacagaccagaagattaccaaggtggcagaactggt
gaagccattgtagatgctgcgctgagtgctctgcgccagctcgtgaaggatcgcctcggg
ggacggagcggaggatacagttctggaaaacaaggcagaagtgatagttcaagtaagaag
gatgtgattgagctgacagacgacagctttgataagaatgttctggacagtgaagatgtt
tggatggttgagttctatgctccttggtgtggacactgcaaaaacctagagccagagtgg
gctgccgcagcttcagaagtaaaagagcagacgaaaggaaaagtgaaactggcagctgtg
gatgctacagtcaatcaggttctggcctcccgatacgggattagaggatttcctacaatc
aagatatttcagaaaggcgagtctcctgtggattatgacggtgggcggacaagatccgac
atcgtgtcccgggcccttgatttgttttctgataacgccccacctcctgagctgcttgag
attatcaacgaggacattgccaagaggacgtgtgaggagcaccagctctgtgttgtggct
gtgctgccccatatccttgatactggagctgcaggcagaaattcttatctggaagttctt
ctgaagttggcagacaaatacaaaaagaaaatgtgggggtggctgtggacagaagctgga
gcccagtctgaacttgagaccgcgttggggattggagggtttgggtaccccgccatggcc
gccatcaatgcacgcaagatgaaatttgctctgctaaaaggctccttcagtgagcaaggc
atcaacgagtttctcagggagctctcttttgggcgtggctccacggcacctgtaggaggc
ggggctttccctaccatcgttgagagagagccttgggacggcagggatggcgagcttccc
gtggaggatgacattgacctcagtgatgtggagcttgatgacttagggaaagatgagttg
tga

DBGET integrated database retrieval system