KEGG   Homo sapiens (human): 10136Help
Entry
10136             CDS       T01001                                 

Gene name
CELA3A, ELA3, ELA3A
Definition
chymotrypsin-like elastase family, member 3A (EC:3.4.21.70)
Orthology
K01345  
pancreatic endopeptidase E [EC:3.4.21.70]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Pancreatic secretion [PATH:hsa04972]
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:hsa04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.12
AA seq 270 aa AA seqDB search
MMLRLLSSLLLVAVASGYGPPSSHSSSRVVHGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISRDLTYQVVLGEYNLAVKEGPEQVIPINSEELFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNKTPCYITGWGRLYTNGPLPDKLQQARL
PVVDYKHCSRWNWWGSTVKKTMVCAGGYIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNFIWKPTVFTRVSAFIDWIEETIASH
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgatgctccggctgctcagttccctcctccttgtggccgttgcctcaggctatggccca
ccttcctctcactcttccagccgcgttgtccatggtgaggatgcggtcccctacagctgg
ccctggcaggtttccctgcagtatgagaaaagtggaagcttctaccacacgtgtggcggt
agcctcatcgcccccgattgggttgtgactgccggccactgcatctcgagggatctgacc
taccaggtggtgttgggtgagtacaaccttgctgtgaaggagggccccgagcaggtgatc
cccatcaactctgaggagctgtttgtgcatccactctggaaccgctcgtgtgtggcctgt
ggcaatgacatcgccctcatcaagctctcacgcagcgcccagctgggagatgccgtccag
ctcgcctcactccctcccgctggtgacatccttcccaacaagacaccctgctacatcacc
ggctggggccgtctctataccaatgggccactcccagacaagctgcagcaggcccggctg
cccgtggtggactataagcactgctccaggtggaactggtggggttccaccgtgaagaaa
accatggtgtgtgctggagggtacatccgctccggctgcaacggtgactctggaggaccc
ctcaactgccccacagaggatggtggctggcaggtccacggtgtgaccagctttgtttct
gcctttggctgcaacttcatctggaagcccacggtgttcactcgagtctccgccttcatc
gactggattgaggagaccatagcaagccactag

DBGET integrated database retrieval system