KEGG   Homo sapiens (human): 1017Help
Entry
1017              CDS       T01001                                 

Gene name
CDK2, CDKN2, p33(CDK2)
Definition
cyclin-dependent kinase 2 (EC:2.7.11.22)
Orthology
K02206  
cyclin-dependent kinase 2 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
FoxO signaling pathway
Cell cycle
Oocyte meiosis
p53 signaling pathway
PI3K-Akt signaling pathway
Progesterone-mediated oocyte maturation
Hepatitis B
Measles
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Prostate cancer
Small cell lung cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    1017 (CDK2)
   04151 PI3K-Akt signaling pathway
    1017 (CDK2)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1017 (CDK2)
   04114 Oocyte meiosis
    1017 (CDK2)
   04115 p53 signaling pathway
    1017 (CDK2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    1017 (CDK2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1017 (CDK2)
   05203 Viral carcinogenesis
    1017 (CDK2)
   05215 Prostate cancer
    1017 (CDK2)
   05222 Small cell lung cancer
    1017 (CDK2)
  Infectious diseases
   05162 Measles
    1017 (CDK2)
   05161 Hepatitis B
    1017 (CDK2)
   05168 Herpes simplex infection
    1017 (CDK2)
   05169 Epstein-Barr virus infection
    1017 (CDK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1017 (CDK2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1017 (CDK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 
4FKL 4EK4 2R3I 1GZ8 4EK3 2R3Q 4GCJ 4FKU 2R3R 2R3F 2R3H 4FKG 4EK6 1JVP 4FKO 4FKS 2R3G 4FKI 4FKP 4FKT 4EK5 3RM6 1OIT 4FKJ 4ACM 2R3N 4EOJ 2R3J 2R3L 2R3P 2VTT 4KD1 4FKV 4EK8 3SW4 3RAI 3R73 3QQJ 3PXZ 2R3K 2R3M 4FKQ 3S1H 3RPO 3RPR 3ROY 3RMF 3RAH 3RAK 3RAL 3R9N 3R7U 3R83 3R6X 3R71 3R28 3QZG 3QZI 3QXO 3QXP 3QX2 3QWJ 3QRT 3QQF 3PY0 3NS9 1H01 4FKW 3SW7 3S00 3RPV 3RK7 3R8M 3R8P 3R1S 3R1Y 3QTQ 3PXY 3PXF 3IG7 3IGG 3DDQ 2R3O 2EXM 1YKR 1HCL 3QTU 3TIY 4NJ3 3SQQ 3RM7 3RK9 3RJC 3R8Z 3R7I 3R1Q 3QWK 3QTR 3QTW 3QQL 2XNB 2VU3 2FVD 2B54 2B55 2BTR 1H07 1E1X 3QQK 3QQH 2B52 4FKR 3UNJ 3RZB 3RPY 3R9O 3R8L 3R8V 3R7Y 3R7E 3QTS 3QQG 3QL8 3PXQ 2XMY 3FZ1 3EZR 2VV9 1HCK 3QHW 1OIR 3QX4 4BGH 3RNI 3R9D 3R7V 3QZH 3QTX 3QU0 3QRU 2C68 2A0C 1PXI 1PW2 1E1V 3PJ8 1PXO 1JSV 4EOP 3TI1 3EZV 2BTS 4LYN 3WBL 4EZ3 4ERW 4EOI 3ULI 3TNW 3S0O 3RK5 3RKB 3R8U 3QZF 3QTZ 3PXR 3LE6 3BHT 2DS1 2B53 1Y8Y 1R78 1PYE 1H1R 1H1S 1KE6 1KE7 1KE8 1KE9 1GII 1B38 1AQ1 3TIZ 3LFQ 2W06 4I3Z 4BCK 4BCO 3PY1 1W8C 1CKP 2UUE 4BCN 4EOM 4EOO 3UNK 3R9H 3MY5 3BHV 1H1P 1DM2 1B39 4II5 4EOQ 2W1H 2W17 2VTP 1Y91 1W98 3QHR 2VTO 4CFN 4EOR 2DUV 1W0X 1H27 1KE5 1GIJ 1FVT 1DI8 1QMZ 1VYZ 1P5E 1H26 2VTM 2C5Y 4BCP 3LFN 3S2P 2WEV 3BHU 2R64 1VYW 1PXJ 1PXP 1PKD 1FIN 1JSU 1V1K 1OIQ 4BCQ 4EOL 4EON 3LFS 3F5X 2A4L 1OKV 4CFW 4BCM 4EZ7 2WIH 2J9M 2G9X 1OKW 1PXL 1PXN 1P2A 1H1Q 1F5Q 2WPA 1PF8 2WFY 1PXM 4EOK 4EOS 2WXV 2WMB 2V22 1URC 1OL2 1BUH 1JST 2C6T 1G5S 3DOG 3DDP 1GY3 2UZD 4FX3 2X1N 2WMA 2WIP 2I40 1PXK 1H28 1GIH 1FVV 2WHB 1OL1 1FQ1 3EID 3EOC 3EJ1 2W05 2VTH 2VTI 2VTJ 2VTL 2VTN 2VTQ 2VTR 2VTS 2VTA 2V0D 2UZL 2UZN 2UZO 2UZB 2UZE 2JGZ 2IW8 2IW9 2IW6 2CLX 2CJM 2CCH 2CCI 2C6I 2C6K 2C6L 2C6M 2C6O 2C69 2C5X 2C5V 2C5N 2C5O 2C4G 2BPM 2BKZ 2BHH 2BHE 1WCC 1URW 1OIU 1OIY 1OI9 1OGU 1H24 1H25 1H0V 1H0W 1H08 1H00 1E9H
Thumbnails

Jmol
Position
12q13
AA seq 238 aa AA seqDB search
MENFQKVEKIGEGTYGVVYKARNKLTGEVVALKKIRLDTLLDVIHTENKLYLVFEFLHQD
LKKFMDASALTGIPLPLIKSYLFQLLQGLAFCHSHRVLHRDLKPQNLLINTEGAIKLADF
GLARAFGVPVRTYTHEVTRRALFPGDSEIDQLFRIFRTLGTPDEVVWPGVTSMPDYKPSF
PKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggagaacttccaaaaggtggaaaagatcggagagggcacgtacggagttgtgtacaaa
gccagaaacaagttgacgggagaggtggtggcgcttaagaaaatccgcctggacacgctg
ctggatgtcattcacacagaaaataaactctacctggtttttgaatttctgcaccaagat
ctcaagaaattcatggatgcctctgctctcactggcattcctcttcccctcatcaagagc
tatctgttccagctgctccagggcctagctttctgccattctcatcgggtcctccaccga
gaccttaaacctcagaatctgcttattaacacagagggggccatcaagctagcagacttt
ggactagccagagcttttggagtccctgttcgtacttacacccatgaggtgactcgccgg
gccctattccctggagattctgagattgaccagctcttccggatctttcggactctgggg
accccagatgaggtggtgtggccaggagttacttctatgcctgattacaagccaagtttc
cccaagtgggcccggcaagattttagtaaagttgtacctcccctggatgaagatggacgg
agcttgttatcgcaaatgctgcactacgaccctaacaagcggatttcggccaaggcagcc
ctggctcaccctttcttccaggatgtgaccaagccagtaccccatcttcgactctga

DBGET integrated database retrieval system