KEGG   Homo sapiens (human): 10179Help
Entry
10179             CDS       T01001                                 

Gene name
RBM7
Definition
(RefSeq) RNA binding motif protein 7
  KO
K13188  
RNA-binding protein 7
Organism
hsa  Homo sapiens (human)
Brite
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    10179 (RBM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q9Y580(Tdark)
UniProt: 
Structure
PDB: 

Jmol
Position
11q23.2
AA seq 266 aa AA seqDB search
MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHE
VSVPYAMNLLNGIKLYGRPIKIQFRSGSSHAPQDVSLSYPQHHVGNSSPTSTSPSRYERT
MDNMTSSAQIIQRSFSSPENFQRQAVMNSALRQMSYGGKFGSSPLDQSGFSPSVQSHSHS
FNQSSSSQWRQGTPSSQRKVRMNSYPYLADRHYSREQRYTDHGSDHHYRGKRDDFFYEDR
NHDDWSHDYDNRRDSSRDGKWRSSRH
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggcggcggcggaagcggatcgcactctctttgtgggcaaccttgaaacgaaa
gtgaccgaggagctccttttcgagcttttccaccaggctgggccagtaataaaggtgaaa
attccaaaagataaggatggtaaaccaaagcagtttgcgtttgtgaatttcaaacatgaa
gtgtctgttccttatgcaatgaatctacttaatggaatcaaactttatggaaggcctatc
aaaattcaatttagatcaggaagtagtcatgccccacaagatgtcagtttgtcatatccc
caacatcatgttggaaattcaagccctacctccacatctcctagcaggtacgaaaggact
atggataacatgacttcatcagcacagataattcagagatctttctcttctccagaaaat
tttcagagacaagcagtgatgaacagtgctttgagacaaatgtcatatggtggaaaattt
ggttcttcacctctggatcaatcaggattttcaccatcagttcaatcacacagtcatagt
ttcaatcagtcttcaagctcccagtggcgccaaggtacaccatcatcacagcgtaaagtc
agaatgaattcttatccctacctagcagatagacattatagccgggaacagcgttacact
gatcatgggtctgaccatcattacagaggaaagagagatgatttcttctatgaagacagg
aatcatgatgactggagccatgactatgataacagaagagacagtagtagagatggaaaa
tggcgctcatctcgacactaa

DBGET integrated database retrieval system