KEGG   Homo sapiens (human): 1019Help
Entry
1019              CDS       T01001                                 

Gene name
CDK4, CMM3, PSK-J3
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing's syndrome
hsa05161  Hepatitis B
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05166  HTLV-I infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05214  Glioma
hsa05218  Melanoma
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05223  Non-small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
Module
hsa_M00692  Cell cycle - G1/S transition
Network
N00066  p21-Cell cycle G1/S
N00067  Deleted p14(ARF) to p21-cell cycle G1/S
N00068  Amplified MDM2 to p21-cell cycle G1/S
N00069  p16-Cell cycle G1/S
N00070  Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  Amplified CDK4 to cell cycle G1/S
N00073  Mutation-activated CDK4 to cell cycle G1/S
N00076  Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00167  KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  KSHV vCyclin to cell cycle G1/S
N00169  KSHV LANA to p21-cell cycle G1/S
N00221  HTLV-I Tax to host-cell-protein activation
N00275  Amplified CCND1 to cell cycle G1/S
Disease
H00030  Cervical cancer
H00038  Melanoma
H00042  Glioma
Drug target
Abemaciclib: D10688
Alvocidib (DG02041): D02880 D09868
Palbociclib (DG01831): D10372 D10652
Ribociclib (DG02084): D10883 D10979
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1019 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1019 (CDK4)
   04115 p53 signaling pathway
    1019 (CDK4)
   04218 Cellular senescence
    1019 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    1019 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    1019 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1019 (CDK4)
   05203 Viral carcinogenesis
    1019 (CDK4)
   05212 Pancreatic cancer
    1019 (CDK4)
   05225 Hepatocellular carcinoma
    1019 (CDK4)
   05214 Glioma
    1019 (CDK4)
   05220 Chronic myeloid leukemia
    1019 (CDK4)
   05218 Melanoma
    1019 (CDK4)
   05219 Bladder cancer
    1019 (CDK4)
   05224 Breast cancer
    1019 (CDK4)
   05222 Small cell lung cancer
    1019 (CDK4)
   05223 Non-small cell lung cancer
    1019 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1019 (CDK4)
   04934 Cushing's syndrome
    1019 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    1019 (CDK4)
   05162 Measles
    1019 (CDK4)
   05161 Hepatitis B
    1019 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1019 (CDK4)
   05165 Human papillomavirus infection
    1019 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    1019 (CDK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1019 (CDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1019 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 1019
NCBI-ProteinID: NP_000066
OMIM: 123829
HGNC: 1773
Ensembl: ENSG00000135446
Vega: OTTHUMG00000170382
Pharos: P11802(Tclin)
UniProt: P11802 A0A024RBB6
Structure
PDB: 

Jmol
Position
12q14.1
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaacgatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system