KEGG   Homo sapiens (human): 1019Help
Entry
1019              CDS       T01001                                 

Gene name
CDK4, CMM3, PSK-J3
Definition
(RefSeq) cyclin dependent kinase 4
  KO
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Endocrine resistance
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Tight junction
T cell receptor signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Hepatitis B
Measles
Human papillomavirus infection
HTLV-I infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Module
Cell cycle - G1/S transition
Network
N00066  
p21-Cell cycle G1/S
N00067  
Deleted p14(ARF) to p21-cell cycle G1/S
N00068  
Amplified MDM2 to p21-cell cycle G1/S
N00069  
p16-Cell cycle G1/S
N00070  
Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  
Deleted p16(INK4a) to p16-cell cycle G1/S
N00072  
Amplified CDK4 to cell cycle G1/S
N00073  
Mutation-activated CDK4 to cell cycle G1/S
N00076  
Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  
Amplified MYC to p15-cell cycle G1/S
N00089  
Amplified MYC to cell cycle G1/S
N00090  
p15-Cell cycle G1/S
N00167  
KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  
KSHV vCyclin to cell cycle G1/S
N00169  
KSHV LANA to p21-cell cycle G1/S
N00221  
HTLV-I Tax to host-cell-protein activation
N00275  
Amplified CCND1 to cell cycle G1/S
Disease
H00030  
Cervical cancer
H00038  
Melanoma
H00042  
Glioma
Drug target
Abemaciclib: 
Alvocidib (DG02041): 
Palbociclib (DG01831): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1019 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1019 (CDK4)
   04115 p53 signaling pathway
    1019 (CDK4)
   04218 Cellular senescence
    1019 (CDK4)
  Cellular community - eukaryotes
   04530 Tight junction
    1019 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    1019 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1019 (CDK4)
   05203 Viral carcinogenesis
    1019 (CDK4)
   05212 Pancreatic cancer
    1019 (CDK4)
   05225 Hepatocellular carcinoma
    1019 (CDK4)
   05214 Glioma
    1019 (CDK4)
   05220 Chronic myeloid leukemia
    1019 (CDK4)
   05218 Melanoma
    1019 (CDK4)
   05219 Bladder cancer
    1019 (CDK4)
   05224 Breast cancer
    1019 (CDK4)
   05222 Small cell lung cancer
    1019 (CDK4)
   05223 Non-small cell lung cancer
    1019 (CDK4)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    1019 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    1019 (CDK4)
   05162 Measles
    1019 (CDK4)
   05161 Hepatitis B
    1019 (CDK4)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1019 (CDK4)
   05165 Human papillomavirus infection
    1019 (CDK4)
  Drug resistance
   01522 Endocrine resistance
    1019 (CDK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1019 (CDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1019 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P11802(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
12q14.1
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaacgatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system