KEGG   Homo sapiens (human): 1019Help
Entry
1019              CDS       T01001                                 

Gene name
CDK4, CMM3, PSK-J3
Definition
cyclin-dependent kinase 4 (EC:2.7.11.22)
Orthology
K02089  
cyclin-dependent kinase 4 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Tight junction
T cell receptor signaling pathway
Hepatitis B
Measles
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Disease
H00030  
Cervical cancer
H00038  
Malignant melanoma
H00042  
Glioma
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1019 (CDK4)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1019 (CDK4)
   04115 p53 signaling pathway
    1019 (CDK4)
  Cell communication
   04530 Tight junction
    1019 (CDK4)
 Organismal Systems
  Immune system
   04660 T cell receptor signaling pathway
    1019 (CDK4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1019 (CDK4)
   05203 Viral carcinogenesis
    1019 (CDK4)
   05212 Pancreatic cancer
    1019 (CDK4)
   05214 Glioma
    1019 (CDK4)
   05220 Chronic myeloid leukemia
    1019 (CDK4)
   05218 Melanoma
    1019 (CDK4)
   05219 Bladder cancer
    1019 (CDK4)
   05222 Small cell lung cancer
    1019 (CDK4)
   05223 Non-small cell lung cancer
    1019 (CDK4)
  Infectious diseases
   05166 HTLV-I infection
    1019 (CDK4)
   05162 Measles
    1019 (CDK4)
   05161 Hepatitis B
    1019 (CDK4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1019 (CDK4)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1019 (CDK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q14
AA seq 303 aa AA seqDB search
MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALL
RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL
MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY
RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR
DVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEG
NPE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggctacctctcgatatgagccagtggctgaaattggtgtcggtgcctatgggacagtg
tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtgagagtcccc
aatggaggaggaggtggaggaggccttcccatcagcacagttcgtgaggtggctttactg
aggcgactggaggcttttgagcatcccaatgttgtccggctgatggacgtctgtgccaca
tcccgaactgaccgggagatcaaggtaaccctggtgtttgagcatgtagaccaggaccta
aggacatatctggacaaggcacccccaccaggcttgccagccgaaacgatcaaggatctg
atgcgccagtttctaagaggcctagatttccttcatgccaattgcatcgttcaccgagat
ctgaagccagagaacattctggtgacaagtggtggaacagtcaagctggctgactttggc
ctggccagaatctacagctaccagatggcacttacacccgtggttgttacactctggtac
cgagctcccgaagttcttctgcagtccacatatgcaacacctgtggacatgtggagtgtt
ggctgtatctttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagcc
gaccagttgggcaaaatctttgacctgattgggctgcctccagaggatgactggcctcga
gatgtatccctgccccgtggagcctttccccccagagggccccgcccagtgcagtcggtg
gtacctgagatggaggagtcgggagcacagctgctgctggaaatgctgacttttaaccca
cacaagcgaatctctgcctttcgagctctgcagcactcttatctacataaggatgaaggt
aatccggagtga

DBGET integrated database retrieval system