KEGG   Homo sapiens (human): 1020Help
Entry
1020              CDS       T01001                                 

Gene name
CDK5, PSSALRE
Definition
cyclin-dependent kinase 5 (EC:2.7.11.22)
Orthology
K02090  
cyclin-dependent kinase 5 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Alzheimer's disease
Cocaine addiction
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    1020 (CDK5)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1020 (CDK5)
  Substance dependence
   05030 Cocaine addiction
    1020 (CDK5)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1020 (CDK5)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1020 (CDK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q36
AA seq 260 aa AA seqDB search
MQKYEKLEKIGEGTYGTVFKAKNRETHEIVALKRVRLDDDDEGVPSSALREICLLKELKH
KNIVRLHDVLHSDKKLTLVFEFCDQDLKKYFDSCNGDLDPEIVKNGELKLADFGLARAFG
IPVRCYSAEVVTLWYRPPDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQL
KRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPV
QRISAEEALQHPYFSDFCPP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatacgagaaactggaaaagattggggaaggcacctacggaactgtgttcaag
gccaaaaaccgggagactcatgagatcgtggctctgaaacgggtgaggctggatgacgat
gatgagggtgtgccgagttccgccctccgggagatctgcctactcaaggagctgaagcac
aagaacatcgtcaggcttcatgacgtcctgcacagcgacaagaagctgactttggttttt
gaattctgtgaccaggacctgaagaagtattttgacagttgcaatggtgacctcgatcct
gagattgtaaagaatggggagctgaaattggctgattttggcctggctcgagcctttggg
attcccgtccgctgttactcagctgaggtggtcacactgtggtaccgcccaccggatgtc
ctctttggggccaagctgtactccacgtccatcgacatgtggtcagccggctgcatcttt
gcagagctggccaatgctgggcggcctctttttcccggcaatgatgtcgatgaccagttg
aagaggatcttccgactgctggggacgcccaccgaggagcagtggccctctatgaccaag
ctgccagactataagccctatccgatgtacccggccacaacatccctggtgaacgtcgtg
cccaaactcaatgccacagggagggatctgctgcagaaccttctgaagtgtaaccctgtc
cagcgtatctcagcagaagaggccctgcagcacccctacttctccgacttctgtccgccc
tag

DBGET integrated database retrieval system