KEGG   Homo sapiens (human): 10209Help
Entry
10209             CDS       T01001                                 

Gene name
EIF1, A121, EIF-1, EIF1A, ISO1, SUI1
Definition
eukaryotic translation initiation factor 1
Orthology
K03113  
translation initiation factor 1
Organism
hsa  Homo sapiens (human)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    10209 (EIF1)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    10209 (EIF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q21.2
AA seq 113 aa AA seqDB search
MSAIQNLHSFDPFADASKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLV
KAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAKDDQLKVHGF
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctatccagaacctccactctttcgacccctttgctgatgcaagtaagggtgat
gacctgcttcctgctggcactgaggattatatccatataagaattcaacagagaaacggc
aggaagacccttactactgtccaagggatcgctgatgattacgataaaaagaaactagtg
aaggcgtttaagaaaaagtttgcctgcaatggtactgtaattgagcatccggaatatgga
gaagtaattcagctacagggtgaccaacgcaagaacatatgccagttcctcgtagagatt
ggactggctaaggacgatcagctgaaggttcatgggttttaa

DBGET integrated database retrieval system