KEGG   Homo sapiens (human): 1021Help
Entry
1021              CDS       T01001                                 

Gene name
CDK6, PLSTIRE
Definition
cyclin-dependent kinase 6 (EC:2.7.11.22)
Orthology
K02091  
cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Hepatitis B
Measles
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Pancreatic cancer
Glioma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Drug target
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1021 (CDK6)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1021 (CDK6)
   04115 p53 signaling pathway
    1021 (CDK6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1021 (CDK6)
   05206 MicroRNAs in cancer
    1021 (CDK6)
   05203 Viral carcinogenesis
    1021 (CDK6)
   05212 Pancreatic cancer
    1021 (CDK6)
   05214 Glioma
    1021 (CDK6)
   05220 Chronic myeloid leukemia
    1021 (CDK6)
   05218 Melanoma
    1021 (CDK6)
   05222 Small cell lung cancer
    1021 (CDK6)
   05223 Non-small cell lung cancer
    1021 (CDK6)
  Infectious diseases
   05162 Measles
    1021 (CDK6)
   05161 Hepatitis B
    1021 (CDK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1021 (CDK6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1021 (CDK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q21-q22
AA seq 326 aa AA seqDB search
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagaccggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gtcgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctctaacctcagtggtc
gtcacgctgtggtacagagcacccgaagtcttgctccagtccagctacgccacccccgtg
gatctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcttggacgtgattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatatcgatgaactaggcaaagacctacttctgaagtgt
ttgacatttaacccagccaaaagaatatctgcctacagtgccctgtctcacccatacttc
caggacctggaaaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

DBGET integrated database retrieval system