KEGG   Homo sapiens (human): 1021Help
Entry
1021              CDS       T01001                                 

Gene name
CDK6, MCPH12, PLSTIRE
Definition
(RefSeq) cyclin dependent kinase 6
  KO
K02091  
cyclin-dependent kinase 6 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Cellular senescence
Cushing's syndrome
Hepatitis B
Measles
Human papillomavirus infection
Kaposi's sarcoma-associated herpesvirus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Pancreatic cancer
Glioma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Module
Cell cycle - G1/S transition
Network
N00066  
p21-Cell cycle G1/S
N00067  
Deleted p14(ARF) to p21-cell cycle G1/S
N00068  
Amplified MDM2 to p21-cell cycle G1/S
N00069  
p16-Cell cycle G1/S
N00070  
Mutation-inactivated p16(INK4a) to p16-cell cycle G1/S
N00071  
Deleted p16(INK4a) to p16-cell cycle G1/S
N00076  
Mutation-inactivated p14(ARF) to p21-cell cycle G1/S
N00088  
Amplified MYC to p15-cell cycle G1/S
N00089  
Amplified MYC to cell cycle G1/S
N00090  
p15-Cell cycle G1/S
N00167  
KSHV vIRF1/3 to p21-cell cycle G1/S
N00168  
KSHV vCyclin to cell cycle G1/S
N00169  
KSHV LANA to p21-cell cycle G1/S
N00203  
KSHV vCyclin to host-cell-protein activation
N00221  
HTLV-I Tax to host-cell-protein activation
N00263  
EBV EBNA3C to host-cell-protein activation
Disease
H00269  
Primary microcephaly (MCPH)
Drug target
Abemaciclib: 
Alvocidib (DG02041): 
Palbociclib (DG01831): 
Ribociclib (DG02084): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    1021 (CDK6)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1021 (CDK6)
   04115 p53 signaling pathway
    1021 (CDK6)
   04218 Cellular senescence
    1021 (CDK6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1021 (CDK6)
   05206 MicroRNAs in cancer
    1021 (CDK6)
   05203 Viral carcinogenesis
    1021 (CDK6)
   05212 Pancreatic cancer
    1021 (CDK6)
   05225 Hepatocellular carcinoma
    1021 (CDK6)
   05214 Glioma
    1021 (CDK6)
   05220 Chronic myeloid leukemia
    1021 (CDK6)
   05218 Melanoma
    1021 (CDK6)
   05224 Breast cancer
    1021 (CDK6)
   05222 Small cell lung cancer
    1021 (CDK6)
   05223 Non-small cell lung cancer
    1021 (CDK6)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1021 (CDK6)
  Infectious diseases
   05162 Measles
    1021 (CDK6)
   05161 Hepatitis B
    1021 (CDK6)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    1021 (CDK6)
   05165 Human papillomavirus infection
    1021 (CDK6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1021 (CDK6)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   1021 (CDK6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q00534(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
7q21.2
AA seq 326 aa AA seqDB search
MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIR
EVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTE
TIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVV
VTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGE
EDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYF
QDLERCKENLDSHLPPSQNTSELNTA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggagaaggacggcctgtgccgcgctgaccagcagtacgaatgcgtggcggagatcggg
gagggcgcctatgggaaggtgttcaaggcccgcgacttgaagaacggaggccgtttcgtg
gcgttgaagcgcgtgcgggtgcagaccggcgaggagggcatgccgctctccaccatccgc
gaggtggcggtgctgaggcacctggagaccttcgagcaccccaacgtggtcaggttgttt
gatgtgtgcacagtgtcacgaacagacagagaaaccaaactaactttagtgtttgaacat
gtcgatcaagacttgaccacttacttggataaagttccagagcctggagtgcccactgaa
accataaaggatatgatgtttcagcttctccgaggtctggactttcttcattcacaccga
gtagtgcatcgcgatctaaaaccacagaacattctggtgaccagcagcggacaaataaaa
ctcgctgacttcggccttgcccgcatctatagtttccagatggctctaacctcagtggtc
gtcacgctgtggtacagagcacccgaagtcttgctccagtccagctacgccacccccgtg
gatctctggagtgttggctgcatatttgcagaaatgtttcgtagaaagcctctttttcgt
ggaagttcagatgttgatcaactaggaaaaatcttggacgtgattggactcccaggagaa
gaagactggcctagagatgttgcccttcccaggcaggcttttcattcaaaatctgcccaa
ccaattgagaagtttgtaacagatatcgatgaactaggcaaagacctacttctgaagtgt
ttgacatttaacccagccaaaagaatatctgcctacagtgccctgtctcacccatacttc
caggacctggaaaggtgcaaagaaaacctggattcccacctgccgcccagccagaacacc
tcggagctgaatacagcctga

DBGET integrated database retrieval system