KEGG   Homo sapiens (human): 10213Help
Entry
10213             CDS       T01001                                 

Gene name
PSMD14, PAD1, POH1, RPN11
Definition
(RefSeq) proteasome 26S subunit, non-ATPase 14 (EC:3.4.19.-)
  KO
K03030  
26S proteasome regulatory subunit N11
Organism
hsa  Homo sapiens (human)
Pathway
Proteasome
Epstein-Barr virus infection
Module
Proteasome, 19S regulatory particle (PA700)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    10213 (PSMD14)
 Human Diseases
  Infectious diseases
   05169 Epstein-Barr virus infection
    10213 (PSMD14)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M67
   10213 (PSMD14)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    10213 (PSMD14)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     10213 (PSMD14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q24.2
AA seq 310 aa AA seqDB search
MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGE
FVDDYTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGC
WLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSN
LGHLNKPSIQALIHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKH
NESVVKEMLELAKNYNKAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCL
AAMLDTVVFK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggacagacttcttagacttggaggaggtatgcctggactgggccaggggccacctaca
gatgctcctgcagtggacacagcagaacaagtctatatctcttccctggcactgttaaaa
atgttaaaacatggccgtgctggagttccaatggaagttatgggtttgatgcttggagaa
tttgttgatgattataccgtcagagtgattgatgtgtttgctatgccacagtcaggaaca
ggtgtcagtgtggaggcagttgatccagtgttccaagctaaaatgttggatatgttgaag
cagacaggaaggccggagatggttgttggttggtatcacagtcaccctggctttggttgt
tggctttctggtgtggatatcaacactcagcagagctttgaagccttgtcggagagagct
gtggcagtggttgtggatcccattcagagtgtaaaaggaaaggttgttattgatgccttc
agattgatcaatgctaatatgatggtcttaggacatgaaccaagacaaacaacttcgaat
ctgggtcacttaaacaagccatctatccaggcattaattcatggactaaacagacattat
tactccattactattaactatcggaaaaatgaactggaacagaagatgttgctaaatttg
cataagaagagttggatggaaggtttgacacttcaggactacagtgaacattgtaaacac
aatgaatcagtggtaaaagagatgttggaattagccaagaattacaataaggctgtagaa
gaagaagataagatgacacctgaacagctggcaataaagaatgttggcaagcaggacccc
aaacgtcatttggaggaacatgtggatgtacttatgacctcaaatattgtccagtgttta
gcagctatgttggatactgtcgtatttaaataa

DBGET integrated database retrieval system