KEGG   Homo sapiens (human): 1022Help
Entry
1022              CDS       T01001                                 

Gene name
CDK7, CAK1, CDKN7, HCAK, MO15, STK1, p39MO15
Definition
cyclin-dependent kinase 7 (EC:2.7.11.23 2.7.11.22)
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    1022 (CDK7)
  Replication and repair
   03420 Nucleotide excision repair
    1022 (CDK7)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1022 (CDK7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     1022 (CDK7)
    2.7.11.23  [RNA-polymerase]-subunit kinase
     1022 (CDK7)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   1022 (CDK7)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     1022 (CDK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12.1
AA seq 346 aa AA seqDB search
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacgtgaagtctcgggcaaagcgttatgagaagctggacttccttggggag
ggacagtttgccaccgtttacaaggccagagataagaacaccaaccaaattgtcgccatt
aagaaaatcaaacttggacatagatcagaagctaaagatggtataaatagaaccgcctta
agagagataaaattattacaggagctaagtcatccaaatataattggtctccttgatgct
tttggacataaatctaatattagccttgtctttgattttatggaaactgatctagaggtt
ataataaaggataatagtcttgtgctgacaccatcacacatcaaagcctacatgttgatg
actcttcaaggattagaatatttacatcaacattggatcctacatagggatctgaaacca
aacaacttgttgctagatgaaaatggagttctaaaactggcagattttggcctggccaaa
tcttttgggagccccaatagagcttatacacatcaggttgtaaccaggtggtatcgggcc
cccgagttactatttggagctaggatgtatggtgtaggtgtggacatgtgggctgttggc
tgtatattagcagagttacttctaagggttccttttttgccaggagattcagaccttgat
cagctaacaagaatatttgaaactttgggcacaccaactgaggaacagtggccggacatg
tgtagtcttccagattatgtgacatttaagagtttccctggaatacctttgcatcacatc
ttcagtgcagcaggagacgacttactagatctcatacaaggcttattcttatttaatcca
tgtgctcgaattacggccacacaggcactgaaaatgaagtatttcagtaatcggccaggg
ccaacacctggatgtcagctgccaagaccaaactgtccagtggaaaccttaaaggagcaa
tcaaatccagctttggcaataaaaaggaaaagaacagaggccttagaacaaggaggattg
cccaagaaactaattttttaa

DBGET integrated database retrieval system