KEGG   Homo sapiens (human): 1022Help
Entry
1022              CDS       T01001                                 

Gene name
CDK7, CAK1, CDKN7, HCAK, MO15, STK1, p39MO15
Definition
cyclin-dependent kinase 7 (EC:2.7.11.23 2.7.11.22)
Orthology
K02202  
cyclin-dependent kinase 7 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Pathway
Basal transcription factors
Nucleotide excision repair
Cell cycle
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:hsa03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:hsa03420]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q12.1
AA seq 346 aa AA seqDB search
MALDVKSRAKRYEKLDFLGEGQFATVYKARDKNTNQIVAIKKIKLGHRSEAKDGINRTAL
REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFMETDLEVIIKDNSLVLTPSHIKAYMLM
TLQGLEYLHQHWILHRDLKPNNLLLDENGVLKLADFGLAKSFGSPNRAYTHQVVTRWYRA
PELLFGARMYGVGVDMWAVGCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDM
CSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPG
PTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLIF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctctggacgtgaagtctcgggcaaagcgttatgagaagctggacttccttggggag
ggacagtttgccaccgtttacaaggccagagataagaacaccaaccaaattgtcgccatt
aagaaaatcaaacttggacatagatcagaagctaaagatggtataaatagaaccgcctta
agagagataaaattattacaggagctaagtcatccaaatataattggtctccttgatgct
tttggacataaatctaatattagccttgtctttgattttatggaaactgatctagaggtt
ataataaaggataatagtcttgtgctgacaccatcacacatcaaagcctacatgttgatg
actcttcaaggattagaatatttacatcaacattggatcctacatagggatctgaaacca
aacaacttgttgctagatgaaaatggagttctaaaactggcagattttggcctggccaaa
tcttttgggagccccaatagagcttatacacatcaggttgtaaccaggtggtatcgggcc
cccgagttactatttggagctaggatgtatggtgtaggtgtggacatgtgggctgttggc
tgtatattagcagagttacttctaagggttccttttttgccaggagattcagaccttgat
cagctaacaagaatatttgaaactttgggcacaccaactgaggaacagtggccggacatg
tgtagtcttccagattatgtgacatttaagagtttccctggaatacctttgcatcacatc
ttcagtgcagcaggagacgacttactagatctcatacaaggcttattcttatttaatcca
tgtgctcgaattacggccacacaggcactgaaaatgaagtatttcagtaatcggccaggg
ccaacacctggatgtcagctgccaagaccaaactgtccagtggaaaccttaaaggagcaa
tcaaatccagctttggcaataaaaaggaaaagaacagaggccttagaacaaggaggattg
cccaagaaactaattttttaa

DBGET integrated database retrieval system