KEGG   Homo sapiens (human): 10242Help
Entry
10242             CDS       T01001                                 

Gene name
KCNMB2
Definition
potassium large conductance calcium-activated channel, subfamily M, beta member 2
Orthology
K04938  
potassium large conductance calcium-activated channel subfamily M beta member 2
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Insulin secretion
Class
Organismal Systems; Endocrine system; Insulin secretion [PATH:hsa04911]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q26.32
AA seq 235 aa AA seqDB search
MFIWTSGRTSSSYRHDEKRNIYQKIRDHDLLDKRKTVTALKAGEDRAILLGLAMMVCSIM
MYFLLGITLLRSYMQSVWTEESQCTLLNASITETFNCSFSCGPDCWKLSQYPCLQVYVNL
TSSGEKLLLYHTEETIKINQKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEG
NQKSVILTKLYSSNVLFHSLFWPTCMMAGGVAIVAMVKLTQYLSLLCERIQRINR
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtttatatggaccagtggccggacctcttcatcttatagacatgatgaaaaaagaaat
atttaccagaaaatcagggaccatgacctcctggacaaaaggaaaacagtcacagcactg
aaggcaggagaggaccgagctattctcctgggactggctatgatggtgtgctccatcatg
atgtattttctgctgggaatcacactcctgcgctcatacatgcagagcgtgtggaccgaa
gagtctcaatgcaccttgctgaatgcgtccatcacggaaacatttaattgctccttcagc
tgtggtccagactgctggaaactttctcagtacccctgcctccaggtgtacgttaacctg
acttcttccggggaaaagctcctcctctaccacacagaagagacaataaaaatcaatcag
aagtgctcctatatacctaaatgtggaaaaaattttgaagaatccatgtccctggtgaat
gttgtcatggaaaacttcaggaagtatcaacacttctcctgctattctgacccagaagga
aaccagaagagtgttatcctaacaaaactctacagttccaacgtgctgttccattcactc
ttctggccaacctgtatgatggctgggggtgtggcaattgttgccatggtgaaacttaca
cagtacctctccctactatgtgagaggatccaacggatcaatagataa

DBGET integrated database retrieval system