KEGG   Homo sapiens (human): 1026Help
Entry
1026              CDS       T01001                                 

Gene name
CDKN1A, CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Definition
cyclin-dependent kinase inhibitor 1A (p21, Cip1)
Orthology
K06625  
cyclin-dependent kinase inhibitor 1A
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Oxytocin signaling pathway
Hepatitis C
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Disease
H00030  
Cervical cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    1026 (CDKN1A)
   04066 HIF-1 signaling pathway
    1026 (CDKN1A)
   04068 FoxO signaling pathway
    1026 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    1026 (CDKN1A)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1026 (CDKN1A)
   04115 p53 signaling pathway
    1026 (CDKN1A)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    1026 (CDKN1A)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1026 (CDKN1A)
   05202 Transcriptional misregulation in cancers
    1026 (CDKN1A)
   05206 MicroRNAs in cancer
    1026 (CDKN1A)
   05205 Proteoglycans in cancer
    1026 (CDKN1A)
   05203 Viral carcinogenesis
    1026 (CDKN1A)
   05214 Glioma
    1026 (CDKN1A)
   05220 Chronic myeloid leukemia
    1026 (CDKN1A)
   05218 Melanoma
    1026 (CDKN1A)
   05219 Bladder cancer
    1026 (CDKN1A)
   05215 Prostate cancer
    1026 (CDKN1A)
  Infectious diseases
   05166 HTLV-I infection
    1026 (CDKN1A)
   05161 Hepatitis B
    1026 (CDKN1A)
   05160 Hepatitis C
    1026 (CDKN1A)
   05169 Epstein-Barr virus infection
    1026 (CDKN1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 164 aa AA seqDB search
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system