KEGG   Homo sapiens (human): 1026Help
Entry
1026              CDS       T01001                                 

Gene name
CDKN1A, CAP20, CDKN1, CIP1, MDA-6, P21, SDI1, WAF1, p21CIP1
Definition
cyclin-dependent kinase inhibitor 1A (p21, Cip1)
Orthology
K06625  
cyclin-dependent kinase inhibitor 1A
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
Oxytocin signaling pathway
Hepatitis C
Hepatitis B
HTLV-I infection
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Glioma
Prostate cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Disease
H00030  
Cervical cancer
Class
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:hsa04068]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:hsa04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:hsa04921]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Proteoglycans in cancer [PATH:hsa05205]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Prostate cancer [PATH:hsa05215]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
Human Diseases; Infectious diseases; Hepatitis B [PATH:hsa05161]
Human Diseases; Infectious diseases; Hepatitis C [PATH:hsa05160]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:hsa05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 164 aa AA seqDB search
MSEPAGDVRQNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaccggctggggatgtccgtcagaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggcccgtgagcgatggaacttcgactttgtcaccgagacaccactggag
ggtgacttcgcctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccccggcgaggccgggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcactgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system