KEGG   Homo sapiens (human): 1027Help
Entry
1027              CDS       T01001                                 

Gene name
CDKN1B, CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Definition
cyclin-dependent kinase inhibitor 1B (p27, Kip1)
Orthology
K06624  
cyclin-dependent kinase inhibitor 1B
Organism
hsa  Homo sapiens (human)
Pathway
ErbB signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
PI3K-Akt signaling pathway
Hepatitis B
Measles
Epstein-Barr virus infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Prostate cancer
Chronic myeloid leukemia
Small cell lung cancer
Disease
H00024  
Prostate cancer
H01102  
Pituitary adenomas
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    1027 (CDKN1B)
   04066 HIF-1 signaling pathway
    1027 (CDKN1B)
   04068 FoxO signaling pathway
    1027 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    1027 (CDKN1B)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    1027 (CDKN1B)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1027 (CDKN1B)
   05202 Transcriptional misregulation in cancers
    1027 (CDKN1B)
   05206 MicroRNAs in cancer
    1027 (CDKN1B)
   05203 Viral carcinogenesis
    1027 (CDKN1B)
   05220 Chronic myeloid leukemia
    1027 (CDKN1B)
   05215 Prostate cancer
    1027 (CDKN1B)
   05222 Small cell lung cancer
    1027 (CDKN1B)
  Infectious diseases
   05162 Measles
    1027 (CDKN1B)
   05161 Hepatitis B
    1027 (CDKN1B)
   05169 Epstein-Barr virus infection
    1027 (CDKN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12p13.1-p12
AA seq 198 aa AA seqDB search
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system