KEGG   Homo sapiens (human): 10274Help
Entry
10274             CDS       T01001                                 

Gene name
STAG1, SA1, SCC3A
Definition
stromal antigen 1
Orthology
K06671  
cohesin complex subunit SA-1/2
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10274 (STAG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3q22.3
AA seq 1258 aa AA seqDB search
MITSELPVLQDSTNETTAHSDAGSELEETEVKGKRKRGRPGRPPSTNKKPRKSPGEKSRI
EAGIRGAGRGRANGHPQQNGEGEPVTLFEVVKLGKSAMQSVVDDWIESYKQDRDIALLDL
INFFIQCSGCRGTVRIEMFRNMQNAEIIRKMTEEFDEDSGDYPLTMPGPQWKKFRSNFCE
FIGVLIRQCQYSIIYDEYMMDTVISLLTGLSDSQVRAFRHTSTLAAMKLMTALVNVALNL
SIHQDNTQRQYEAERNKMIGKRANERLELLLQKRKELQENQDEIENMMNSIFKGIFVHRY
RDAIAEIRAICIEEIGVWMKMYSDAFLNDSYLKYVGWTLHDRQGEVRLKCLKALQSLYTN
RELFPKLELFTNRFKDRIVSMTLDKEYDVAVEAIRLVTLILHGSEEALSNEDCENVYHLV
YSAHRPVAVAAGEFLHKKLFSRHDPQAEEALAKRRGRNSPNGNLIRMLVLFFLESELHEH
AAYLVDSLWESSQELLKDWECMTELLLEEPVQGEEAMSDRQESALIELMVCTIRQAAEAH
PPVGRGTGKRVLTAKERKTQIDDRNKLTEHFIITLPMLLSKYSADAEKVANLLQIPQYFD
LEIYSTGRMEKHLDALLKQIKFVVEKHVESDVLEACSKTYSILCSEEYTIQNRVDIARSQ
LIDEFVDRFNHSVEDLLQEGEEADDDDIYNVLSTLKRLTSFHNAHDLTKWDLFGNCYRLL
KTGIEHGAMPEQIVVQALQCSHYSILWQLVKITDGSPSKEDLLVLRKTVKSFLAVCQQCL
SNVNTPVKEQAFMLLCDLLMIFSHQLMTGGREGLQPLVFNPDTGLQSELLSFVMDHVFID
QDEENQSMEGDEEDEANKIEALHKRRNLLAAFSKLIIYDIVDMHAAADIFKHYMKYYNDY
GDIIKETLSKTRQIDKIQCAKTLILSLQQLFNELVQEQGPNLDRTSAHVSGIKELARRFA
LTFGLDQIKTREAVATLHKDGIEFAFKYQNQKGQEYPPPNLAFLEVLSEFSSKLLRQDKK
TVHSYLEKFLTEQMMERREDVWLPLISYRNSLVTGGEDDRMSVNSGSSSSKTSSVRNKKG
RPPLHKKRVEDESLDNTWLNRTDTMIQTPGPLPAPQLTSTVLRENSRPMGDQIQEPESEH
GSEPDFLHNPQMQISWLGQPKLEDLNRKDRTGMNYMKVRTGVRHAVRGLMEEDAEPIFED
VMMSSRSQLEDMNEEFEDTMVIDLPPSRNRRERAELRPDFFDSAAIIEDDSGFGMPMF
NT seq 3777 nt NT seq  +upstreamnt  +downstreamnt
atgattacttcagaattaccagtgttacaggattcaactaatgaaactactgcccattcc
gatgctggcagcgagcttgaagaaacagaggtcaaaggaaaaagaaaaaggggtcgtcct
ggccggcctccatctacaaataagaaacctcgaaaatctccaggtgagaagagcagaatt
gaagctggaattagaggagcaggccgtggaagagctaatggacaccctcaacagaatggg
gaaggggagcctgtcacattatttgaggtggtgaaactggggaaaagtgcaatgcagtcc
gtggtggatgactggattgaatcatataaacaagacagggacatcgcacttctggattta
atcaacttttttatccagtgttcaggatgtcgaggtactgtgagaatagagatgtttcga
aatatgcagaatgcagaaatcatcagaaaaatgactgaagaatttgatgaggacagtggt
gattatcctcttaccatgcctggacctcagtggaaaaaatttcgttcaaacttttgtgaa
tttattggagtcctgattcgacagtgtcagtatagcataatttatgatgagtatatgatg
gacacagtaatctcccttttgacgggtttgtcagactcccaggtcagagcttttaggcat
acaagtaccctggctgccatgaagctcatgactgctctggtgaatgttgccttaaacctc
agtattcatcaggataatacccagagacaatatgaagccgagagaaataaaatgattggg
aagagagccaatgaaaggttggagttactacttcagaaacgcaaagagctgcaagaaaat
caggatgaaatcgaaaatatgatgaactctatttttaagggtatatttgttcatagatac
cgtgatgctattgctgagattagagccatttgtattgaagaaattggagtatggatgaaa
atgtatagtgatgccttcctaaatgacagttacctaaaatatgttggctggactcttcat
gacaggcaaggggaagtcaggctgaagtgtttgaaagctctgcagagtctatataccaat
agagaattattccccaaattggaactattcactaaccgattcaaggatcgcattgtatca
atgacacttgataaagaatatgatgttgctgtggaagctattcgattggttactctgata
cttcatggaagtgaagaagctctttccaatgaagactgtgaaaatgtttaccacttggtg
tactcggcacatcgccctgttgctgtggcagctggagagttccttcacaaaaagctattt
agcagacatgacccacaagcagaagaagcattagcaaagaggaggggaagaaacagcccg
aatggaaacctcattaggatgctggttcttttctttcttgaaagtgagttacatgaacat
gcagcctacttggtggacagtttatgggagagctctcaagaactgttgaaagactgggaa
tgtatgacagagttgctattagaagaacctgttcaaggagaggaagcaatgtctgatcgt
caagagagtgctcttatagagctaatggtttgtacaattcgtcaagctgctgaggcacat
cctccagtgggaaggggtaccggcaagagagtgctaactgccaaagaaaggaaaactcaa
attgatgatagaaacaaattgactgaacattttattattacacttcctatgttactgtca
aagtattctgcagatgcagagaaggtagcaaacttgctacaaatcccacagtattttgat
ttagaaatctacagcacaggtagaatggaaaagcatctggatgctttattaaaacagatt
aagtttgttgtggagaaacacgtagaatcagatgttctagaagcctgcagtaaaacctat
agtatcttatgcagtgaagaatataccatccagaacagagttgacatagctcgaagccag
ctgattgatgagtttgtagatcgattcaatcattctgtggaagacctattgcaagaggga
gaagaagctgatgatgatgacatttacaatgttctttctacattaaagcggttaacttct
tttcacaatgcacatgatctcacaaaatgggatctctttggtaattgctacagattattg
aagactggaattgaacatggagccatgccagaacagatagtcgtgcaagcactgcagtgt
tcccattattcgattctttggcagttggtgaaaattactgatggctctccttccaaagag
gatttgttggtattgaggaaaacggtgaaatcctttttggctgtttgccagcagtgcctg
tctaatgttaatactccagtgaaagaacaggctttcatgttactctgtgatcttctgatg
attttcagccaccaattaatgacaggtggcagagagggccttcagcctttggtgttcaat
ccagatactggactccaatctgaactcctcagttttgtgatggatcacgtttttattgac
caagacgaggagaaccagagcatggagggtgatgaagaagatgaagctaataaaattgag
gccttacataaaagaaggaatctacttgctgctttcagcaaacttatcatttatgacatt
gttgacatgcatgcagctgcagacatcttcaaacactacatgaagtattacaatgactat
ggtgatattattaaggaaacactgagtaaaaccaggcagattgataaaattcagtgtgcc
aagactctcattctcagtttgcaacagttatttaatgaacttgttcaagagcaaggtccc
aacctagataggacatctgcccatgtcagtggcattaaagaactggcacgtcgctttgcc
cttacatttggattggaccagattaagacacgagaagcagttgccacacttcacaaggat
ggcatagagtttgcatttaaataccaaaatcagaaaggacaagagtatccacctcctaat
ctggcttttcttgaagtactaagtgaattttcttctaaacttcttcgacaggacaaaaag
acagttcattcatacctagagaaattccttaccgagcagatgatggaaaggagggaggat
gtatggcttccactcatctcctatagaaattcattagtcactgggggtgaagatgataga
atgtctgtgaacagtggaagtagcagcagcaaaacctcatcagtaaggaataagaaagga
cgacctccacttcataaaaaacgagtagaagatgagagtctggataacacatggctaaac
aggactgacaccatgattcagactcctggccccctgccagcaccacaactcacatccact
gtactgcgggagaacagtcggcccatgggagaccagattcaagaacctgagtctgaacat
ggttctgaaccagactttttacacaatcctcagatgcagatctcttggttaggccagccg
aagttagaagacttaaatcggaaggacagaacaggaatgaactacatgaaagtgagaact
ggagtgaggcatgctgttcggggtctaatggaggaagatgctgagcccatctttgaagat
gtgatgatgtcatcccgaagccagttagaagatatgaatgaagaatttgaggacaccatg
gttattgatctgcctccatcaagaaatcggcgagagagagctgagctaaggccagacttc
tttgactctgcagctatcatagaagatgattcaggatttggaatgcctatgttctga

DBGET integrated database retrieval system