KEGG   Homo sapiens (human): 1029Help
Entry
1029              CDS       T01001                                 

Gene name
CDKN2A, ARF, CDK4I, CDKN2, CMM2, INK4, INK4A, MLM, MTS-1, MTS1, P14, P14ARF, P16, P16-INK4A, P16INK4, P16INK4A, P19, P19ARF, TP16
Definition
cyclin-dependent kinase inhibitor 2A
Orthology
K06621  
cyclin-dependent kinase inhibitor 2A
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
p53 signaling pathway
HTLV-I infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Pancreatic cancer
Glioma
Melanoma
Bladder cancer
Chronic myeloid leukemia
Non-small cell lung cancer
Disease
H00004  
Chronic myeloid leukemia (CML)
H00008  
Burkitt lymphoma
H00009  
Adult T-cell leukemia
H00014  
Non-small cell lung cancer
H00015  
Malignant pleural mesothelioma
H00016  
Oral cancer
H00017  
Esophageal cancer
H00019  
Pancreatic cancer
H00022  
Bladder cancer
H00025  
Penile cancer
H00036  
Osteosarcoma
H00038  
Malignant melanoma
H00040  
Squamous cell carcinoma
H00042  
Glioma
H00045  
Malignant islet cell carcinoma
H00046  
Cholangiocarcinoma
H00047  
Gallbladder cancer
H00048  
Hepatocellular carcinoma
H00054  
Nasopharyngeal cancer
H00055  
Laryngeal cancer
H00409  
Type II diabetes mellitus
Class
Cellular Processes; Cell growth and death; Cell cycle [PATH:hsa04110]
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Cancers; Pancreatic cancer [PATH:hsa05212]
Human Diseases; Cancers; Glioma [PATH:hsa05214]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Melanoma [PATH:hsa05218]
Human Diseases; Cancers; Bladder cancer [PATH:hsa05219]
Human Diseases; Cancers; Non-small cell lung cancer [PATH:hsa05223]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:hsa05166]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9p21
AA seq 156 aa AA seqDB search
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVA
ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEE
LGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atggagccggcggcggggagcagcatggagccttcggctgactggctggccacggccgcg
gcccggggtcgggtagaggaggtgcgggcgctgctggaggcgggggcgctgcccaacgca
ccgaatagttacggtcggaggccgatccaggtcatgatgatgggcagcgcccgagtggcg
gagctgctgctgctccacggcgcggagcccaactgcgccgaccccgccactctcacccga
cccgtgcacgacgctgcccgggagggcttcctggacacgctggtggtgctgcaccgggcc
ggggcgcggctggacgtgcgcgatgcctggggccgtctgcccgtggacctggctgaggag
ctgggccatcgcgatgtcgcacggtacctgcgcgcggctgcggggggcaccagaggcagt
aaccatgcccgcatagatgccgcggaaggtccctcagacatccccgattga

DBGET integrated database retrieval system