KEGG   Homo sapiens (human): 10319Help
Entry
10319             CDS       T01001                                 

Gene name
LAMC3, OCCM
Definition
laminin, gamma 3
Orthology
K06247  
laminin, gamma 3
Organism
hsa  Homo sapiens (human)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    10319 (LAMC3)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    10319 (LAMC3)
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    10319 (LAMC3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    10319 (LAMC3)
   05222 Small cell lung cancer
    10319 (LAMC3)
  Infectious diseases
   05146 Amoebiasis
    10319 (LAMC3)
   05145 Toxoplasmosis
    10319 (LAMC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31-q34
AA seq 1575 aa AA seqDB search
MAAAALLLGLALLAPRAAGAGMGACYDGAGRPQRCLPVFENAAFGRLAQASHTCGSPPED
FCPHVGAAGAGAHCQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNI
TLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLR
PGEDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQEWVTSTELLISLDR
LNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTD
CERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTGHGGRCHHCRDHTA
GPHCERCQENFYHWDPRMPCQPCDCQSAGSLHLQCDDTGTCACKPTVTGWKCDRCLPGFH
SLSEGGCRPCTCNPAGSLDTCDPRSGRCPCKENVEGNLCDRCRPGTFNLQPHNPAGCSSC
FCYGHSKVCASTAQFQVHHILSDFHQGAEGWWARSVGGSEHPPQWSPNGVLLSPEDEEEL
TAPEKFLGDQRFSYGQPLILTFRVPPGDSPLPVQLRLEGTGLALSLRHSSLSGPQDAGHP
REVELRFHLQETSEDVAPPLPPFHFQRLLANLTSLRLRVSPGPSPAGPVFLTEVRLTSAR
PGLSPPASWVEICSCPTGYTGQFCESCAPGYKREMPQGGPYASCVPCTCNQHGTCDPNTG
ICVCSHHTEGPSCERCLPGFYGNPFAGQADDCQPCPCPGQSACTTIPESREVVCTHCPPG
QRGRRCEVCDDGFFGDPLGLFGHPQPCHQCQCSGNVDPNAVGNCDPLSGHCLRCLHNTTG
DHCEHCQEGFYGSALAPRPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSR
CYPGFFDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCTCRPGVTGQACDRCQLGFFGFSIK
GCRACRCSPLGAASAQCHENGTCVCRPGFEGYKCDRCHDNFFLTADGTHCQQCPSCYALV
KEEAAKLKARLTLTEGWLQGSDCGSPWGPLDILLGEAPRGDVYQGHHLLPGAREAFLEQM
MSLEGAVKAAREQLQRLNKGARCAQAGSQKTCTQLADLEAVLESSEEEILHAAAILASLE
IPQEGPSQPTKWSHLATEARALARSHRDTATKIAATAWRALLASNTSYALLWNLLEGRVA
LETQRDLEDRYQEVQAAQKALRTAVAEVLPEAESVLATVQQVGADTAPYLALLASPGALP
QKSRAEDLGLKAKALEKTVASWQHMATEAARTLQTAAQATLRQTEPLTKLHQEARAALTQ
ASSSVQAATVTVMGARTLLADLEGMKLQFPRPKDQAALQRKADSVSDRLLADTRKKTKQA
ERMLGNAAPLSSSAKKKGREAEVLAKDSAKLAKALLRERKQAHRRASRLTSQTQATLQQA
SQQVLASEARRQELEEAERVGAGLSEMEQQIRESRISLEKDIETLSELLARLGSLDTHQA
PAQALNETQWALERLRLQLGSPGSLQRKLSLLEQESQQQELQIQGFESDLAEIRADKQNL
EAILHSLPENCASWQ
NT seq 4728 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgcgcttctgctggggctggcgctgctggcaccgcgggcggccggcgcg
ggcatgggcgcgtgctatgacggcgcagggcgcccgcagcgctgcctgccggtgttcgag
aacgcggcgtttgggcggctcgcccaggcctcgcacacgtgcggcagcccgcccgaggac
ttctgtccccacgtgggcgccgcgggcgcgggggctcattgccagcgctgcgacgccgcc
gacccccagcgccaccacaacgcctcctacctcaccgacttccacagccaggacgagagc
acctggtggcagagcccgtccatggccttcggcgtgcagtaccccacctcggtcaacatc
accctccgcctagggaaggcttatgagatcacgtatgtgaggctgaagttccacaccagt
cgccctgagagctttgccatctacaagcgcagccgcgccgacggcccatgggagccctac
cagttctacagcgcctcctgccagaagacctacggccggcccgagggccagtacctgcgc
cccggcgaggacgagcgcgtggccttctgcacctctgagttcagcgacatctccccgctg
agtggcggcaacgtggccttctccaccctggagggccggcccagcgcctacaacttcgag
gagagccctgggctgcaggagtgggtcaccagcaccgaactcctcatctctctagaccgg
ctcaacacgtttggggacgacatcttcaaggaccccaaggtgctccagtcctactattat
gccgtgtccgacttctctgtgggcggcaggtgcaagtgcaacgggcatgccagcgagtgc
ggccccgacgtggcaggccagttggcctgccggtgccagcacaacaccaccggcacagac
tgtgagcgctgcctgcccttcttccaggaccgcccgtgggcccggggcaccgccgaggct
gcccacgagtgtctgccctgcaactgcagtggccgctccgaggaatgcacgtttgatcgg
gagctcttccgcagcacaggccacggcgggcgctgtcaccactgccgtgaccacacagct
gggccacactgtgagcgctgtcaggagaatttctatcactgggacccgcggatgccatgc
cagccctgtgactgccagtcggcaggctccctacacctccagtgcgatgacacaggcacc
tgcgcctgcaagcccacggtgactggctggaagtgtgaccgctgtctgcccgggttccac
tcgctcagtgagggaggctgcagaccctgcacttgcaatcccgctggcagcctggacacc
tgtgacccccgcagtgggcgctgcccctgcaaagagaatgtggaaggcaacctatgtgac
agatgtcgcccggggacctttaacctgcagccccacaatccagctggctgcagcagctgt
ttctgctatggccactccaaggtgtgcgcgtccactgcccagttccaggtgcatcacatc
ctcagcgatttccaccagggagccgaaggctggtgggccagaagtgtggggggctctgag
caccccccacaatggagcccaaatggggtcctcctgagcccagaagacgaggaggagctc
acagcaccagagaagttcctgggagaccagcggttcagctatgggcagcccctcatactg
accttccgggtgccccccggggactccccactccctgtacagctgaggctggaagggaca
ggcttggccctgtccctgaggcactctagcctgtctggcccccaggatgccgggcatccc
agggaggtagagctcaggttccacctgcaggagacctccgaggacgtggcccctccactg
ccccccttccacttccagcggctcctcgccaacctgaccagcctccgcctccgcgtcagt
cccggccccagccctgccggtccagtgttcctgactgaggtccggctcacatccgcccgg
ccagggctttccccgccagcctcctgggtggagatttgttcatgtcccactggctacacg
ggccagttctgtgaatcctgtgctccgggatacaagagggagatgccacaggggggtccc
tatgccagctgtgtcccctgcacctgtaaccagcatggcacctgtgaccccaacacaggg
atctgtgtctgcagccaccataccgagggcccatcctgtgaacgctgtttgccaggtttc
tatggcaaccctttcgcgggccaagccgacgactgccagccctgtccctgccctggccag
tcggcctgtacgaccatcccagagagccgggaggtggtgtgtacccactgccccccgggc
cagagagggcggcgctgtgaggtctgtgatgatggcttttttggggacccgctggggctc
tttgggcacccccagccctgccaccagtgccagtgtagcgggaacgtggaccccaatgcc
gtgggcaactgtgaccccctgtctggccactgcctgcgctgcctgcacaacaccacgggt
gaccactgtgagcactgtcaggaaggcttctacgggagcgccctggcccctcgacccgca
gacaaatgcatgccttgcagctgtcacccacagggctcggtcagtgagcagatgccctgc
gacccagtgacaggccaatgctcctgcctgcctcatgtgactgcacgggactgcagccgc
tgctaccctggcttcttcgacctccagcctgggaggggctgccggagctgcaagtgtcac
ccactgggctcccaggaggaccagtgccatcccaagactggacagtgcacctgccgccca
ggtgtcacaggccaggcctgtgacaggtgccagctgggtttcttcggcttctccatcaag
ggctgccgggcctgcaggtgctccccactgggcgctgcctcggcccagtgccacgagaac
ggcacatgcgtgtgcaggcctggcttcgagggctacaaatgtgaccgctgccacgacaac
ttcttcctcacggcagacggcacacactgccagcaatgtccgtcctgctacgccctggtg
aaggaggaggcagccaagctgaaggccagactgactttgacggaggggtggctccaaggg
tccgactgtggcagtccctggggaccactagacattctgctgggagaggccccaaggggg
gacgtctaccagggccatcacctgcttccaggggctcgggaagccttcctggagcagatg
atgagcctcgagggtgctgtcaaggccgcccgggagcagctgcagaggctgaacaagggt
gcccgctgtgcccaggccggatcccagaagacctgcacccagctggcagacctggaggca
gtgctggagtcctcggaagaggagattctgcatgcagctgccattctcgcgtctctggag
attcctcaggaaggtcccagtcagccgaccaaatggagccacctggccacagaggcccgt
gccctcgccaggagccacagagacaccgccaccaagatcgcagccactgcttggagggcc
ctgctcgcctccaacaccagctacgcgcttctctggaatctgctggagggaagggtggcc
ctagagacccagcgggacctggaggacaggtaccaggaggtccaggcggcccagaaagca
ctgaggacggctgtggcagaggtgctgcctgaagcggaaagcgtgttggccaccgtgcag
caagttggcgcagatacagccccgtacctggccttgctggcttccccgggagctctgcct
cagaagtcccgggctgaagacctgggcctgaaggcgaaggccctggagaagacagttgca
tcatggcagcacatggccactgaggctgcccgaaccctccagactgctgcccaggcgacg
ctacggcaaacagaacccctcacaaagctgcaccaggaggccagagccgccctgacccag
gcttcctcatctgtccaggctgcgacagtgactgtcatgggagccaggactctgctggct
gatctggaaggaatgaagctgcagtttccccggcccaaggaccaggcggcattgcagagg
aaggcagactccgtcagtgacagactccttgcagacacgagaaagaagaccaagcaggcg
gagaggatgctgggaaacgcggcccctctttcctccagtgccaagaagaagggcagagaa
gcagaggtgttggccaaggacagtgccaagcttgccaaggccttgctgagggagcggaaa
caggcgcaccgccgtgccagcaggctcaccagccagacgcaagccacgctccaacaggcg
tcccagcaggtgctggcgtctgaagcacgcagacaggagctggaggaagctgagcgggtg
ggtgctgggctgagcgagatggagcagcagatccgggaatcgcgtatctcactggagaag
gacatcgagaccttgtcagagctgcttgccaggctggggtcgctggacacccatcaagcc
ccagcccaggccctgaacgagactcagtgggcactagaacgcctgaggctgcagctgggc
tccccggggtccttgcagaggaaactcagtctgctggagcaggaatcccagcagcaggag
ctgcagatccagggcttcgagagtgacctcgccgagatccgcgccgacaaacagaacctg
gaggccattctgcacagcctgcccgagaactgtgccagctggcagtga

DBGET integrated database retrieval system