KEGG   Homo sapiens (human): 10325Help
Entry
10325             CDS       T01001                                 

Gene name
RRAGB, RAGB, bA465E19.1
Definition
Ras-related GTP binding B
Orthology
K16185  
Ras-related GTP-binding protein A/B
Organism
hsa  Homo sapiens (human)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    10325 (RRAGB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
Xp11.21
AA seq 346 aa AA seqDB search
MEESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSII
FANYIARDTRRLGATIDVEHSHVRFLGNLVLNLWDCGGQDTFMENYFTSQRDNIFRNVEV
LIYVFDVESRELEKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREED
LRRLSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVLLFE
RATFLVISHYQCKEQRDAHRFEKISNIIKQFKLSCSKLAASFQSMEVRNSNFAAFIDIFT
SNTYVMVVMSDPSIPSAATLINIRNARKHFEKLERVDGPKQCLLMR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatctgactctgagaaaacgacggagaaagaaaatctggggccgagaatggat
ccaccactaggggaaccggaaggatcgcttgggtgggtgctaccaaatacagccatgaag
aaaaaggtgctgttgatgggtaaaagtgggtctggtaagaccagcatgaggtctattatc
tttgcaaattatattgccagagacacacgtcgccttggcgcaacaattgatgtagaacat
tctcatgttcgatttctgggaaacctggtattgaacctgtgggattgtggtgggcaagac
accttcatggaaaattatttcactagccaacgggacaacatcttccgaaatgtggaggtt
ctgatttatgtctttgatgtggagagccgcgaactggaaaaggacatgcactattaccaa
tcatgcctggaggccattctgcagaattctccagatgccaaaatattttgcttggtacac
aaaatggatctggtacaggaggatcaacgggacctgatttttaaagagcgagaagaagat
ttgaggcgtttgtctcgcccattggaatgttcttgtttccgaacatctatctgggatgaa
accctctataaggcttggtccagcatagtttatcagctgattcccaatgttcagcagctg
gaaatgaacctaaggaattttgctgaaattatcgaagctgatgaagtacttctttttgag
agagctacttttctggtaatttctcactatcagtgtaaagagcagcgtgatgcccataga
tttgagaaaataagcaacattattaagcagttcaagctgagctgcagcaagctggctgcc
tctttccagagtatggaagtcaggaactctaacttcgctgctttcattgacatctttaca
tccaacacttatgtgatggttgtgatgtctgatccgtccattccttctgcagctactctg
atcaacatccgcaatgccaggaaacactttgaaaagctggaaagagtggatggaccaaag
cagtgtcttctcatgcgctaa

DBGET integrated database retrieval system