KEGG   Homo sapiens (human): 10381Help
Entry
10381             CDS       T01001                                 

Gene name
TUBB3, CDCBM, CDCBM1, CFEOM3A, TUBB4, beta-4, FEOM3
Definition
tubulin, beta 3 class III
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Disease
H00838  
Congenital fibrosis of the extraocular muscles (CFEOM)
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Cell communication; Gap junction [PATH:hsa04540]
Human Diseases; Infectious diseases; Pathogenic Escherichia coli infection [PATH:hsa05130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 378 aa AA seqDB search
MDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQG
FQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQL
VENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLT
VATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNST
AIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEE
EGEMYEDDEEESEAQGPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgtccgctcaggggcctttggacatctcttcaggcctgacaatttcatcttt
ggtcagagtggggccggcaacaactgggccaagggtcactacacggagggggcggagctg
gtggattcggtcctggatgtggtgcggaaggagtgtgaaaactgcgactgcctgcagggc
ttccagctgacccactcgctggggggcggcacgggctccggcatgggcacgttgctcatc
agcaaggtgcgtgaggagtatcccgaccgcatcatgaacaccttcagcgtcgtgccctca
cccaaggtgtcagacacggtggtggagccctacaacgccacgctgtccatccaccagctg
gtggagaacacggatgagacctactgcatcgacaacgaggcgctctacgacatctgcttc
cgcaccctcaagctggccacgcccacctacggggacctcaaccacctggtatcggccacc
atgagcggagtcaccacctccttgcgcttcccgggccagctcaacgctgacctgcgcaag
ctggccgtcaacatggtgcccttcccgcgcctgcacttcttcatgcccggcttcgccccc
ctcacagcccggggcagccagcagtaccgggccctgaccgtgcccgagctcacccagcag
atgttcgatgccaagaacatgatggccgcctgcgacccgcgccacggccgctacctgacg
gtggccaccgtgttccggggccgcatgtccatgaaggaggtggacgagcagatgctggcc
atccagagcaagaacagcagctacttcgtggagtggatccccaacaacgtgaaggtggcc
gtgtgtgacatcccgccccgcggcctcaagatgtcctccaccttcatcgggaacagcacg
gccatccaggagctgttcaagcgcatctccgagcagttcacggccatgttccggcgcaag
gccttcctgcactggtacacgggcgagggcatggacgagatggagttcaccgaggccgag
agcaacatgaacgacctggtgtccgagtaccagcagtaccaggacgccacggccgaggaa
gagggcgagatgtacgaagacgacgaggaggagtcggaggcccagggccccaagtga

DBGET integrated database retrieval system