KEGG   Homo sapiens (human): 10381Help
Entry
10381             CDS       T01001                                 

Gene name
TUBB3, CDCBM, CDCBM1, CFEOM3, CFEOM3A, FEOM3, TUBB4, beta-4
Definition
tubulin, beta 3 class III
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Disease
H00838  
Congenital fibrosis of the extraocular muscles (CFEOM)
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10381 (TUBB3)
  Cell communication
   04540 Gap junction
    10381 (TUBB3)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10381 (TUBB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10381 (TUBB3)
  Exosomal proteins of colorectal cancer cells
   10381 (TUBB3)
  Exosomal proteins of bladder cancer cells
   10381 (TUBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16q24.3
AA seq 378 aa AA seqDB search
MDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQG
FQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQL
VENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRK
LAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLT
VATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNST
AIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEE
EGEMYEDDEEESEAQGPK
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggacagtgtccgctcaggggcctttggacatctcttcaggcctgacaatttcatcttt
ggtcagagtggggccggcaacaactgggccaagggtcactacacggagggggcggagctg
gtggattcggtcctggatgtggtgcggaaggagtgtgaaaactgcgactgcctgcagggc
ttccagctgacccactcgctggggggcggcacgggctccggcatgggcacgttgctcatc
agcaaggtgcgtgaggagtatcccgaccgcatcatgaacaccttcagcgtcgtgccctca
cccaaggtgtcagacacggtggtggagccctacaacgccacgctgtccatccaccagctg
gtggagaacacggatgagacctactgcatcgacaacgaggcgctctacgacatctgcttc
cgcaccctcaagctggccacgcccacctacggggacctcaaccacctggtatcggccacc
atgagcggagtcaccacctccttgcgcttcccgggccagctcaacgctgacctgcgcaag
ctggccgtcaacatggtgcccttcccgcgcctgcacttcttcatgcccggcttcgccccc
ctcacagcccggggcagccagcagtaccgggccctgaccgtgcccgagctcacccagcag
atgttcgatgccaagaacatgatggccgcctgcgacccgcgccacggccgctacctgacg
gtggccaccgtgttccggggccgcatgtccatgaaggaggtggacgagcagatgctggcc
atccagagcaagaacagcagctacttcgtggagtggatccccaacaacgtgaaggtggcc
gtgtgtgacatcccgccccgcggcctcaagatgtcctccaccttcatcgggaacagcacg
gccatccaggagctgttcaagcgcatctccgagcagttcacggccatgttccggcgcaag
gccttcctgcactggtacacgggcgagggcatggacgagatggagttcaccgaggccgag
agcaacatgaacgacctggtgtccgagtaccagcagtaccaggacgccacggccgaggaa
gagggcgagatgtacgaagacgacgaggaggagtcggaggcccagggccccaagtga

DBGET integrated database retrieval system