KEGG   Homo sapiens (human): 10382Help
Entry
10382             CDS       T01001                                 

Gene name
TUBB4A, DYT4, TUBB4, TUBB5, beta-5
Definition
tubulin, beta 4A class IVa
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10382 (TUBB4A)
  Cell communication
   04540 Gap junction
    10382 (TUBB4A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10382 (TUBB4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10382 (TUBB4A)
  Exosomal proteins of colorectal cancer cells
   10382 (TUBB4A)
  Exosomal proteins of bladder cancer cells
   10382 (TUBB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
19p13.3
AA seq 495 aa AA seqDB search
MRRGAADRETERLPGAQGPCSAVSAASSTLAAAAAPRARATAAASTLSATAMREIVHLQA
GQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYVPRAVLVDLE
PGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVVRKEAESCDC
LQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVVEPYNATLSV
HQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNAD
LRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGR
YLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRGLKMAATFIG
NSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDAT
AEEGEFEEEAEEEVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggggggctgcggaccgagaaactgagcggctcccgggggcgcagggaccgtgc
tccgccgtctccgccgcatcttccaccctcgccgccgccgcagctccccgcgctcgtgcc
accgccgccgcgtccaccctcagcgccaccgccatgcgggagatcgtgcacctgcaggcc
ggccagtgcggcaaccagatcggggccaagttttgggaggttatcagtgacgaacatggc
atcgaccccacaggcacataccatggggacagtgacctgcaactggagaggatcaacgtg
tactacaacgaggccacaggaggaaattatgtccccagagcggtgctggtggacctggaa
cccggcaccatggactctgtccgttctggccccttcggtcagatctttcggccggacaac
ttcgtgtttggccaatccggagccggcaacaactgggcaaaggggcactacacggagggc
gcagagctggtggacgctgtcctggacgtagtccggaaggaggccgagagctgcgactgc
cttcagggcttccagctgacccactcgctggggggtggcacggggtccggaatgggcacg
ctgctcatcagtaagatccgcgaggagttcccagaccgcatcatgaacaccttcagcgtg
gtgccctcgcccaaagtgtcagacacggtggtggagccctacaacgccacgctgtctgtg
caccagctggtggagaatacggatgagacctactgcatcgacaacgaggcactctacgac
atctgtttccgcaccctcaagctgaccacccccacctacggggacctcaaccacctggtg
tcggccaccatgagcggggtcaccacctgcctgcgcttcccgggccagctgaacgccgac
ctgcgcaagctggccgtcaacatggttccctttcctcgcctgcacttcttcatgcccggc
ttcgcacccctgaccagccggggcagccagcagtaccgggccctgacggtgcccgagctc
acccagcagatgttcgatgccaagaacatgatggcggcgtgcgacccgcgccacggccgc
tacctgaccgtggccgccgtgttccggggccgcatgtccatgaaggaggtggacgagcag
atgctgagcgtgcagagcaagaacagcagctacttcgtggagtggatccccaacaacgtg
aagacggccgtgtgcgacatcccgccccgcggcctgaagatggccgcgaccttcatcggc
aacagcacggccatccaggagctgttcaagcgcatctccgagcagttcacggccatgttc
cggcgcaaggccttcttgcactggtacacgggcgagggcatggacgagatggagttcacc
gaggccgagagcaacatgaatgacctggtatctgagtaccagcagtaccaggacgccacg
gccgaggagggcgagttcgaggaggaggcggaggaggaggtggcctag

DBGET integrated database retrieval system