KEGG   Homo sapiens (human): 10382Help
Entry
10382             CDS       T01001                                 

Gene name
TUBB4A, DYT4, TUBB4, beta-5
Definition
(RefSeq) tubulin beta 4A class IVa
  KO
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Disease
H00679  
Hypomyelinating leukodystrophy
Drug target
Batabulin (DG01412): 
Brentuximab vedotin: 
Cabazitaxel (DG00695): 
Colchicine: 
Docetaxel (DG00694): 
Eribulin: 
Estramustine (DG00724): 
Indibulin: 
Lexibulin: 
Maytansine: 
Paclitaxel: 
Paclitaxel poliglumex: 
Podophyllotoxin: 
Soblidotin: 
Taltobulin: 
Trastuzumab emtansine (DG01358): 
Verubulin (DG01411): 
Vinblastine (DG00689): 
Vincristine (DG00690): 
Vindesine (DG00691): 
Vinepidine sulfate: 
Vinflunine: 
Vinglycinate sulfate: 
Vinleurosine sulfate: 
Vinorelbine (DG00692): 
Vinrosidine sulfate: 
Vintafolide: 
Vinzolidine sulfate: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10382 (TUBB4A)
  Cellular community - eukaryotes
   04540 Gap junction
    10382 (TUBB4A)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10382 (TUBB4A)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     10382 (TUBB4A)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    10382 (TUBB4A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10382 (TUBB4A)
  Exosomal proteins of colorectal cancer cells
   10382 (TUBB4A)
  Exosomal proteins of bladder cancer cells
   10382 (TUBB4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P04350(Tclin)
UniProt: 
Position
19p13.3
AA seq 444 aa AA seqDB search
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGNYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDAVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEFPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLSVQSKNSSYFVEWIPNNVKTAVCDIPPRG
LKMAATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEGEFEEEAEEEVA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgcgggagatcgtgcacctgcaggccggccagtgcggcaaccagatcggggccaagttt
tgggaggttatcagtgacgaacatggcatcgaccccacaggcacataccatggggacagt
gacctgcaactggagaggatcaacgtgtactacaacgaggccacaggaggaaattatgtc
cccagagcggtgctggtggacctggaacccggcaccatggactctgtccgttctggcccc
ttcggtcagatctttcggccggacaacttcgtgtttggccaatccggagccggcaacaac
tgggcaaaggggcactacacggagggcgcagagctggtggacgctgtcctggacgtagtc
cggaaggaggccgagagctgcgactgccttcagggcttccagctgacccactcgctgggg
ggtggcacggggtccggaatgggcacgctgctcatcagtaagatccgcgaggagttccca
gaccgcatcatgaacaccttcagcgtggtgccctcgcccaaagtgtcagacacggtggtg
gagccctacaacgccacgctgtctgtgcaccagctggtggagaatacggatgagacctac
tgcatcgacaacgaggcactctacgacatctgtttccgcaccctcaagctgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctgaacgccgacctgcgcaagctggccgtcaacatggttcccttt
cctcgcctgcacttcttcatgcccggcttcgcacccctgaccagccggggcagccagcag
taccgggccctgacggtgcccgagctcacccagcagatgttcgatgccaagaacatgatg
gcggcgtgcgacccgcgccacggccgctacctgaccgtggccgccgtgttccggggccgc
atgtccatgaaggaggtggacgagcagatgctgagcgtgcagagcaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatggccgcgaccttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcttgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaatgacctggtatct
gagtaccagcagtaccaggacgccacggccgaggagggcgagttcgaggaggaggcggag
gaggaggtggcctag

DBGET integrated database retrieval system