KEGG   Homo sapiens (human): 10383Help
Entry
10383             CDS       T01001                                 

Gene name
TUBB4B, Beta2, TUBB2, TUBB2C
Definition
tubulin, beta 4B class IVb
Orthology
K07375  
tubulin beta
Organism
hsa  Homo sapiens (human)
Pathway
Phagosome
Gap junction
Pathogenic Escherichia coli infection
Drug target
Podophyllotoxin: 
Vinblastine: 
Vincristine: 
Vindesine: 
Vinorelbine: 
Vintafolide: 
Paclitaxel: 
Docetaxel: 
Paclitaxel poliglumex: 
Eribulin: 
Colchicine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    10383 (TUBB4B)
  Cellular commiunity
   04540 Gap junction
    10383 (TUBB4B)
 Human Diseases
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    10383 (TUBB4B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   10383 (TUBB4B)
  Exosomal proteins of colorectal cancer cells
   10383 (TUBB4B)
  Exosomal proteins of bladder cancer cells
   10383 (TUBB4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q34
AA seq 445 aa AA seqDB search
MREIVHLQAGQCGNQIGAKFWEVISDEHGIDPTGTYHGDSDLQLERINVYYNEATGGKYV
PRAVLVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKEAESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATAEEEGEFEEEAEEEVA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtgcacttgcaggccgggcagtgcggcaaccaaatcggcgccaagttt
tgggaggtgatcagcgatgagcacggcatcgaccccacgggcacctaccacggggacagc
gacctgcagctggaacgcatcaacgtgtactacaatgaggccaccggcggcaagtacgtg
ccccgcgccgtgctcgtggatctggagcccggcaccatggactccgtgcgctcggggccc
ttcgggcagatcttccggccggacaacttcgttttcggtcagagtggtgctgggaacaac
tgggccaaggggcactacacagaaggcgcggagctggtggactcggtgctggatgttgtg
agaaaggaggctgagagctgtgactgcctgcagggtttccagctgacccactccctgggt
ggggggactgggtctgggatgggtaccctcctcatcagcaagatccgggaggagtaccca
gacaggatcatgaacacgtttagtgtggtgccttcgcccaaagtgtcagacacagtggtg
gagccctacaacgccaccctctcagtccaccagctcgtagaaaacacagacgagacctac
tgcattgataacgaagctctctacgacatttgcttcagaaccctaaagctgaccacgccc
acctatggtgacctgaaccacctggtgtctgctaccatgagtggggtcaccacctgcctg
cgcttcccaggccagctcaatgctgacctgcggaagctggctgtgaacatggtcccgttt
ccccggctgcacttcttcatgcccggctttgccccactgaccagccggggcagccagcag
taccgggcgctgaccgtgcccgagctcacccagcagatgtttgatgccaagaacatgatg
gctgcctgcgacccccgccatggccgctacctgacggttgccgccgtgttcaggggccgc
atgtccatgaaggaggtggatgagcaaatgcttaatgtccaaaacaaaaacagcagctat
tttgttgagtggatccccaacaatgtgaaaacggctgtctgtgacatcccacctcggggg
ctaaaaatgtccgccaccttcattggcaacagcacggccatccaggagctgttcaagcgc
atctccgagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaatgacctggtgtcc
gagtaccagcagtaccaggatgccacagccgaggaggagggcgagttcgaggaggaggct
gaggaggaggtggcctag

DBGET integrated database retrieval system