KEGG   Homo sapiens (human): 10423Help
Entry
10423             CDS       T01001                                 

Gene name
CDIPT, PIS, PIS1
Definition
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC:2.7.8.11)
Orthology
K00999  
CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:hsa00562]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:hsa04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 168 aa AA seqDB search
MPDENIFLFVPNLIGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASH
WLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPL
VGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgaaaatatcttcctgttcgtgcccaacctcatcggaacccggtttggggcc
atgctggacatgctgacggaccgctgctccaccatgtgcctgttggtcaacctggccctg
ctgtaccctggagccacgctgttcttccaaatcagcatgagtttggatgtggccagtcac
tggctgcacctccacagttctgtggtccgaggcagtgagagtcacaagatgatcgacttg
tccgggaatccggtgcttcggatctactacacctcgaggcctgctctgttcaccttgtgt
gctgggaatgagctcttctactgcctcctctacctgttccatttctctgagggaccttta
gttggctctgtgggactgttccggatgggcctctgggtcactgcccccatcgccttgctg
aagtcgctcatcagcgtcatccacctgatcacggccgcccgcaacatggctgccctggac
gcagcagaccgcgccaagaagaagtga

DBGET integrated database retrieval system