KEGG   Homo sapiens (human): 10423Help
Entry
10423             CDS       T01001                                 

Gene name
CDIPT, PIS, PIS1
Definition
CDP-diacylglycerol--inositol 3-phosphatidyltransferase (EC:2.7.8.11)
Orthology
K00999  
CDP-diacylglycerol--inositol 3-phosphatidyltransferase [EC:2.7.8.11]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Glycerophospholipid metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    10423 (CDIPT)
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    10423 (CDIPT)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    10423 (CDIPT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.11  CDP-diacylglycerol---inositol 3-phosphatidyltransferase
     10423 (CDIPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p11.2
AA seq 168 aa AA seqDB search
MPDENIFLFVPNLIGTRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASH
WLHLHSSVVRGSESHKMIDLSGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPL
VGSVGLFRMGLWVTAPIALLKSLISVIHLITAARNMAALDAADRAKKK
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgaaaatatcttcctgttcgtgcccaacctcatcggaacccggtttggggcc
atgctggacatgctgacggaccgctgctccaccatgtgcctgttggtcaacctggccctg
ctgtaccctggagccacgctgttcttccaaatcagcatgagtttggatgtggccagtcac
tggctgcacctccacagttctgtggtccgaggcagtgagagtcacaagatgatcgacttg
tccgggaatccggtgcttcggatctactacacctcgaggcctgctctgttcaccttgtgt
gctgggaatgagctcttctactgcctcctctacctgttccatttctctgagggaccttta
gttggctctgtgggactgttccggatgggcctctgggtcactgcccccatcgccttgctg
aagtcgctcatcagcgtcatccacctgatcacggccgcccgcaacatggctgccctggac
gcagcagaccgcgccaagaagaagtga

DBGET integrated database retrieval system