KEGG   Homo sapiens (human): 10451Help
Entry
10451             CDS       T01001                                 

Gene name
VAV3
Definition
vav 3 guanine nucleotide exchange factor
Orthology
K05730  
guanine nucleotide exchange factor VAV
Organism
hsa  Homo sapiens (human)
Pathway
cAMP signaling pathway
Chemokine signaling pathway
Focal adhesion
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    10451 (VAV3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    10451 (VAV3)
  Cellular commiunity
   04510 Focal adhesion
    10451 (VAV3)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    10451 (VAV3)
   04660 T cell receptor signaling pathway
    10451 (VAV3)
   04662 B cell receptor signaling pathway
    10451 (VAV3)
   04664 Fc epsilon RI signaling pathway
    10451 (VAV3)
   04666 Fc gamma R-mediated phagocytosis
    10451 (VAV3)
   04670 Leukocyte transendothelial migration
    10451 (VAV3)
   04062 Chemokine signaling pathway
    10451 (VAV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p13.3
AA seq 287 aa AA seqDB search
MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQ
AGDTVELLKGDAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERL
QAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLM
ELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGNSLLSPKVLGIAIARYDFC
ARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgccaatttttacatttctttcagaacaagggacactcaaactaccagagaaacggacc
aatggactgcgaagaactcctaaacaggtggatccaggtttaccaaagatgcaggtcatt
aggaactattctggaacaccacccccagctctgcatgaaggaccccctttacagctccag
gccggggataccgttgaacttctgaaaggagatgcacacagtctgttttggcagggcaga
aatttagcatctggagaggttggattttttccaagtgatgcagtcaagccttgcccatgt
gtgcccaaaccagtagattattcttgccaaccctggtatgctggagcaatggaaagattg
caagcagagaccgaacttattaatagggtaaatagtacttaccttgtgaggcacaggacc
aaagagtcaggagaatatgcaattagcattaagtacaataatgaagcaaagcacatcaag
attttaacaagagatggcttttttcacattgcagaaaatagaaaatttaaaagtttaatg
gaacttgtggagtactacaagcatcattctctcaaggaagggttcagaaccttagataca
actctgcagtttccatacaaggagccagaacattcagctggacagaggggtaatagagca
ggcaacagcttgttaagtccaaaagtgctgggcattgccatcgctcggtatgacttctgt
gcaagagatatgagagagttgtccttgttgaaaggagatgtggtgaagatttacacaaag
atgagtgcaaatggctggtggagaggagaagtaaatggcagggtgggctggtttccatcc
acatatgtggaagaggatgaataa

DBGET integrated database retrieval system