KEGG   Homo sapiens (human): 10459Help
Entry
10459             CDS       T01001                                 

Gene name
MAD2L2, FANCV, MAD2B, POLZ2, REV7
Definition
(RefSeq) mitotic arrest deficient 2 like 2
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
Module
hsa_M00293  DNA polymerase zeta complex
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10459 (MAD2L2)
   04114 Oocyte meiosis
    10459 (MAD2L2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10459 (MAD2L2)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    10459 (MAD2L2)
   05100 Bacterial invasion of epithelial cells
    10459 (MAD2L2)
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     10459 (MAD2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA
Motif
Other DBs
NCBI-GeneID: 10459
NCBI-ProteinID: NP_001120797
OMIM: 604094
HGNC: 6764
Ensembl: ENSG00000116670
Vega: OTTHUMG00000002231
Pharos: Q9UI95(Tbio)
UniProt: Q9UI95 A0A024R4I4
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 211 aa AA seqDB search
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcacacgacaagacctcaactttggccaagtggtggccgatgtgctctgc
gagttcctggaggtggctgtgcatctcatcctctacgtgcgcgaggtctaccccgtgggc
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aatcagtatatccaggacacgctgcactgcgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gagatcacccagcctccactgctgtccatcagctcagactcgctgttgtctcatgtggag
cagctgctccgggccttcatcctgaagatcagcgtgtgcgatgccgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagccgccactcgcaacatg
gagaagatccaggtcatcaaggatttcccctggatcctggcggatgagcaggatgtccac
atgcatgacccccggctgataccactaaaaaccatgacgtcggacattttaaagatgcag
ctttacgtggaagagcgcgctcataaaggcagctga

DBGET integrated database retrieval system