KEGG   Homo sapiens (human): 10459Help
Entry
10459             CDS       T01001                                 

Gene name
MAD2L2, MAD2B, POLZ2, REV7
Definition
MAD2 mitotic arrest deficient-like 2 (yeast)
Orthology
K13728  
mitotic spindle assembly checkpoint protein MAD2B
Organism
hsa  Homo sapiens (human)
Pathway
Cell cycle
Oocyte meiosis
Progesterone-mediated oocyte maturation
Bacterial invasion of epithelial cells
Shigellosis
Module
DNA polymerase zeta  complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    10459 (MAD2L2)
   04114 Oocyte meiosis
    10459 (MAD2L2)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10459 (MAD2L2)
 Human Diseases
  Infectious diseases
   05131 Shigellosis
    10459 (MAD2L2)
   05100 Bacterial invasion of epithelial cells
    10459 (MAD2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36
AA seq 211 aa AA seqDB search
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcacacgacaagacctcaactttggccaagtggtggccgatgtgctctgc
gagttcctggaggtggctgtgcatctcatcctctacgtgcgcgaggtctaccccgtgggc
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aatcagtatatccaggacacgctgcactgcgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gagatcacccagcctccactgctgtccatcagctcagactcgctgttgtctcatgtggag
cagctgctccgggccttcatcctgaagatcagcgtgtgcgatgccgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagccgccactcgcaacatg
gagaagatccaggtcatcaaggatttcccctggatcctggcggatgagcaggatgtccac
atgcatgacccccggctgataccactaaaaaccatgacgtcggacattttaaagatgcag
ctttacgtggaagagcgcgctcataaaggcagctga

DBGET integrated database retrieval system