KEGG   Homo sapiens (human): 10465Help
Entry
10465             CDS       T01001                                 

Gene name
PPIH, CYP-20, CYPH, SnuCyp-20, USA-CYP
Definition
peptidylprolyl isomerase H (cyclophilin H) (EC:5.2.1.8)
Orthology
K09567  
peptidyl-prolyl isomerase H (cyclophilin H) [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Class
Genetic Information Processing; Transcription; Spliceosome [PATH:hsa03040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p34.1
AA seq 177 aa AA seqDB search
MAVANSSPVNPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGY
KGSTFHRVIKDFMIQGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTN
GCQFFITCSKCDWLDGKHVVFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcaaattcaagtcctgttaaccccgtggtgttctttgatgtcagtattggc
ggtcaggaagttggccgcatgaagatcgagctctttgcagacgttgtgcctaagacggcc
gagaactttaggcagttctgcaccggagaattcaggaaagatggggttccaataggatac
aaaggaagcaccttccacagggtcataaaggatttcatgattcagggtggagattttgtt
aatggagatggtactggagtcgccagtatttaccgggggccatttgcagatgaaaatttt
aaacttagacactcagctccaggcctgctttccatggcgaacagtggtccaagtacaaat
ggctgtcagttctttatcacctgctctaagtgcgattggctggatgggaagcatgtggtg
tttggaaaaatcatcgatggacttctagtgatgagaaagattgagaatgttcccacaggc
cccaacaataagcccaagctacctgtggtgatctcgcagtgtggggagatgtag

DBGET integrated database retrieval system