KEGG   Homo sapiens (human): 10477Help
Entry
10477             CDS       T01001                                 

Gene name
UBE2E3, UBCH9, UbcM2
Definition
ubiquitin-conjugating enzyme E2E 3 (EC:6.3.2.19)
Orthology
K06689  
ubiquitin-conjugating enzyme E2 D/E [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:hsa04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q32.1
AA seq 207 aa AA seqDB search
MSSDRQRSDDESPSTSSGSSDADQRDPAAPEPEEQEERKPSATQQKKNTKLSSKTTAKLS
TSAKRIQKELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSSDY
PFKPPKVTFRTRIYHCNINSQGVICLDILKDNWSPALTISKVLLSICSLLTDCNPADPLV
GSIATQYLTNRAEHDRIARQWTKRYAT
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtgataggcaaaggtccgatgatgagagccccagcaccagcagtggcagttca
gatgcggaccagcgagacccagccgctccagagcctgaagaacaagaggaaagaaaacct
tctgccacccagcagaagaaaaacaccaaactctctagcaaaaccactgctaagttatcc
actagtgctaaaagaattcagaaggagctagctgaaataacccttgatcctcctcctaat
tgcagtgctgggcctaaaggagataacatttatgaatggagatcaactatacttggtcca
ccgggttctgtatatgaaggtggtgtgttttttctggatatcacattttcatcagattat
ccatttaagccaccaaaggttactttccgcaccagaatctatcactgcaacatcaacagt
cagggagtcatctgtctggacatccttaaagacaactggagtcccgctttgactatttca
aaggttttgctgtctatttgttcccttttgacagactgcaaccctgcggatcctctggtt
ggaagcatagccactcagtatttgaccaacagagcagaacacgacaggatagccagacag
tggaccaagagatacgcaacataa

DBGET integrated database retrieval system