KEGG   Homo sapiens (human): 10488Help
Entry
10488             CDS       T01001                                 

Gene name
CREB3, LUMAN, LZIP
Definition
cAMP responsive element binding protein 3
Orthology
K09048  
cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Cholinergic synapse
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Vasopressin-regulated water reabsorption
Huntington's disease
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    10488 (CREB3)
   04024 cAMP signaling pathway
    10488 (CREB3)
   04022 cGMP - PKG signaling pathway
    10488 (CREB3)
   04151 PI3K-Akt signaling pathway
    10488 (CREB3)
   04152 AMPK signaling pathway
    10488 (CREB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    10488 (CREB3)
   04915 Estrogen signaling pathway
    10488 (CREB3)
   04918 Thyroid hormone synthesis
    10488 (CREB3)
   04916 Melanogenesis
    10488 (CREB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10488 (CREB3)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    10488 (CREB3)
  Nervous system
   04725 Cholinergic synapse
    10488 (CREB3)
   04728 Dopaminergic synapse
    10488 (CREB3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10488 (CREB3)
   05215 Prostate cancer
    10488 (CREB3)
  Neurodegenerative diseases
   05016 Huntington's disease
    10488 (CREB3)
  Substance dependence
   05030 Cocaine addiction
    10488 (CREB3)
   05031 Amphetamine addiction
    10488 (CREB3)
   05034 Alcoholism
    10488 (CREB3)
  Infectious diseases
   05161 Hepatitis B
    10488 (CREB3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    10488 (CREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
UniProt: 
Position
9p13.3
AA seq 371 aa AA seqDB search
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaattggatgctggtgaccaagacctgctggccttcctgctagaggaaagt
ggagatttggggacggcacccgatgaggccgtgagggccccactggactgggcgctgccg
ctttctgaggtaccgagcgactgggaagtagatgatttgctgtgctccctgctgagtccc
ccagcgtcgttgaacattctcagctcctccaacccctgccttgtccaccatgaccacacc
tactccctcccacgggaaactgtctctatggatctagagagtgagagctgtagaaaagag
gggacccagatgactccacagcatatggaggagctggcagagcaggagattgctaggcta
gtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgagaca
cttcctctcactaagacagaggaacaaattctgaaacgtgtgcggaggaagattcgaaat
aaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagagagc
agggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagcttctggag
gaacagaatttgtcccttctagatcaactgaggaaactccaggccatggtgattgagata
tcaaacaaaaccagcagcagcagcacctgcatcttggtcctactagtctccttctgcctc
ctccttgtacctgctatgtactcctctgacacaagggggagcctgccagctgagcatgga
gtgttgtcccgccagcttcgtgccctccccagtgaggacccttaccagctggagctgcct
gccctgcagtcagaagtgccgaaagacagcacacaccagtggttggacggctcagactgt
gtactccaggcccctggcaacacttcctgcctgctgcattacatgcctcaggctcccagt
gcagagcctcccctggagtggccattccctgacctcttctcagagcctctctgccgaggt
cccatcctccccctgcaggcaaatctcacaaggaagggaggatggcttcctactggtagc
ccctctgtcattttgcaggacagatactcaggctag

DBGET integrated database retrieval system