KEGG   Homo sapiens (human): 10488Help
Entry
10488             CDS       T01001                                 

Gene name
CREB3, LUMAN, LZIP, sLZIP
Definition
(RefSeq) cAMP responsive element binding protein 3
  KO
K09048  cyclic AMP-responsive element-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04931  Insulin resistance
hsa04934  Cushing's syndrome
hsa04962  Vasopressin-regulated water reabsorption
hsa05016  Huntington's disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05165  Human papillomavirus infection
hsa05203  Viral carcinogenesis
hsa05215  Prostate cancer
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    10488 (CREB3)
   04024 cAMP signaling pathway
    10488 (CREB3)
   04022 cGMP - PKG signaling pathway
    10488 (CREB3)
   04151 PI3K-Akt signaling pathway
    10488 (CREB3)
   04152 AMPK signaling pathway
    10488 (CREB3)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    10488 (CREB3)
   04922 Glucagon signaling pathway
    10488 (CREB3)
   04915 Estrogen signaling pathway
    10488 (CREB3)
   04926 Relaxin signaling pathway
    10488 (CREB3)
   04918 Thyroid hormone synthesis
    10488 (CREB3)
   04928 Parathyroid hormone synthesis, secretion and action
    10488 (CREB3)
   04916 Melanogenesis
    10488 (CREB3)
   04925 Aldosterone synthesis and secretion
    10488 (CREB3)
   04927 Cortisol synthesis and secretion
    10488 (CREB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    10488 (CREB3)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    10488 (CREB3)
  Nervous system
   04725 Cholinergic synapse
    10488 (CREB3)
   04728 Dopaminergic synapse
    10488 (CREB3)
  Aging
   04211 Longevity regulating pathway - mammal
    10488 (CREB3)
  Environmental adaptation
   04714 Thermogenesis
    10488 (CREB3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    10488 (CREB3)
   05215 Prostate cancer
    10488 (CREB3)
  Neurodegenerative diseases
   05016 Huntington's disease
    10488 (CREB3)
  Substance dependence
   05030 Cocaine addiction
    10488 (CREB3)
   05031 Amphetamine addiction
    10488 (CREB3)
   05034 Alcoholism
    10488 (CREB3)
  Endocrine and metabolic diseases
   04931 Insulin resistance
    10488 (CREB3)
   04934 Cushing's syndrome
    10488 (CREB3)
  Infectious diseases
   05161 Hepatitis B
    10488 (CREB3)
   05165 Human papillomavirus infection
    10488 (CREB3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    10488 (CREB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf GIT_CC
Motif
Other DBs
NCBI-GeneID: 10488
NCBI-ProteinID: NP_006359
OMIM: 606443
HGNC: 2347
Ensembl: ENSG00000107175
Vega: OTTHUMG00000019872
Pharos: O43889(Tbio)
UniProt: O43889
Position
9p13.3
AA seq 371 aa AA seqDB search
MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSP
PASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARL
VLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLES
RVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCL
LLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDC
VLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGS
PSVILQDRYSG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaattggatgctggtgaccaagacctgctggccttcctgctagaggaaagt
ggagatttggggacggcacccgatgaggccgtgagggccccactggactgggcgctgccg
ctttctgaggtaccgagcgactgggaagtagatgatttgctgtgctccctgctgagtccc
ccagcgtcgttgaacattctcagctcctccaacccctgccttgtccaccatgaccacacc
tactccctcccacgggaaactgtctctatggatctagagagtgagagctgtagaaaagag
gggacccagatgactccacagcatatggaggagctggcagagcaggagattgctaggcta
gtactgacagatgaggagaagagtctattggagaaggaggggcttattctgcctgagaca
cttcctctcactaagacagaggaacaaattctgaaacgtgtgcggaggaagattcgaaat
aaaagatctgctcaagagagccgcaggaaaaagaaggtgtatgttgggggtttagagagc
agggtcttgaaatacacagcccagaatatggagcttcagaacaaagtacagcttctggag
gaacagaatttgtcccttctagatcaactgaggaaactccaggccatggtgattgagata
tcaaacaaaaccagcagcagcagcacctgcatcttggtcctactagtctccttctgcctc
ctccttgtacctgctatgtactcctctgacacaagggggagcctgccagctgagcatgga
gtgttgtcccgccagcttcgtgccctccccagtgaggacccttaccagctggagctgcct
gccctgcagtcagaagtgccgaaagacagcacacaccagtggttggacggctcagactgt
gtactccaggcccctggcaacacttcctgcctgctgcattacatgcctcaggctcccagt
gcagagcctcccctggagtggccattccctgacctcttctcagagcctctctgccgaggt
cccatcctccccctgcaggcaaatctcacaaggaagggaggatggcttcctactggtagc
ccctctgtcattttgcaggacagatactcaggctag

DBGET integrated database retrieval system